• Gene id: 91608

Gene Summary

• Gene Symbol: RASL10B   Gene   UCSC   Ensembl
• Aliases: RRP17, VTS58635
• Gene name: RAS like family 10 member B
• Alternate names: ras-like protein family member 10B, Ras-related protein 17, alternative protein RASL10B, ras-like protein VTS58635,
• Gene location: 17q12 (35731638: 35743520)     Exons: 6     NC_000017.11
• OMIM: 605064

Protein Summary

• Protein general information: Q96S79  
  • Name: Ras like protein family member 10B (Ras like protein VTS58635) (Ras related protein 17) (RRP17)
  • Length: 203  
  • Mass: 23229
  • Tissue specificity: Expressed at high levels in skeletal muscle and, at much lower levels, in heart, brain and pancreas. {ECO
• Sequence:

  MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWA
  DTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKT
  WKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAIM

• Structural information:
  • Interpro: IPR027417  IPR001806  IPR020849  
  • Prosite: PS51421
  • STRING: ENSP00000474230
• Other Databases: GeneCards:  RASL10B  Malacards:  RASL10B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090277	positive regulation of peptide hormone secretion	ISS	biological process
GO:0003050	regulation of systemic arterial blood pressure by atrial natriuretic peptide	ISS	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0090277	positive regulation of peptide hormone secretion	IEA	biological process
GO:0003050	regulation of systemic arterial blood pressure by atrial natriuretic peptide	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray