• Gene id: 91607

Gene Summary

• Gene Symbol: SLFN11   Gene   UCSC   Ensembl
• Aliases: SLFN8/9
• Gene name: schlafen family member 11
• Alternate names: schlafen family member 11,
• Gene location: 17q12 (35373913: 35350304)     Exons: 7     NC_000017.11
• OMIM: 614953

Protein Summary

• Protein general information: Q7Z7L1  
  • Name: Schlafen family member 11 (EC 3.6. . )
  • Length: 901  
  • Mass: 102836
  • Tissue specificity: Exhibits a wider expression range in ovarian and colon adenocarcinoma than in their corresponding healthy tissues. {ECO
• Sequence:

  MEANQCPLVVEPSYPDLVINVGEVTLGEENRKKLQKIQRDQEKERVMRAACALLNSGGGVIRMAKKVEHPVEMGL
  DLEQSLRELIQSSDLQAFFETKQQGRCFYIFVKSWSSGPFPEDRSVKPRLCSLSSSLYRRSETSVRSMDSREAFC
  FLKTKRKPKILEEGPFHKIHKGVYQELPNSDPADPNSDPADLIFQKDYLEYGEILPFPESQLVEFKQFSTKHFQE
  YVKRTIPEYVPAFANTGGGYLFIGVDDKSREVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIV
  NVLKRGELYGYACMIRVNPFCCAVFSEAPNSWIVEDKYVCSLTTEKWVGMMTDTDPDLLQLSEDFECQLSLSSGP
  PLSRPVYSKKGLEHKKELQQLLFSVPPGYLRYTPESLWRDLISEHRGLEELINKQMQPFFRGILIFSRSWAVDLN
  LQEKPGVICDALLIAQNSTPILYTILREQDAEGQDYCTRTAFTLKQKLVNMGGYTGKVCVRAKVLCLSPESSAEA
  LEAAVSPMDYPASYSLAGTQHMEALLQSLVIVLLGFRSLLSDQLGCEVLNLLTAQQYEIFSRSLRKNRELFVHGL
  PGSGKTIMAMKIMEKIRNVFHCEAHRILYVCENQPLRNFISDRNICRAETRKTFLRENFEHIQHIVIDEAQNFRT
  EDGDWYGKAKSITRRAKGGPGILWIFLDYFQTSHLDCSGLPPLSDQYPREELTRIVRNADPIAKYLQKEMQVIRS
  NPSFNIPTGCLEVFPEAEWSQGVQGTLRIKKYLTVEQIMTCVADTCRRFFDRGYSPKDVAVLVSTAKEVEHYKYE
  LLKAMRKKRVVQLSDACDMLGDHIVLDSVRRFSGLERSIVFGIHPRTADPAILPNVLICLASRAKQHLYIFPWGG
  H

• Structural information:
  • Interpro: IPR018647  IPR027417  IPR029684  IPR007421  IPR038461  
  • STRING: ENSP00000378067
• Other Databases: GeneCards:  SLFN11  Malacards:  SLFN11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000049	tRNA binding	IBA	molecular function
GO:0051607	defense response to virus	IBA	biological process
GO:0000049	tRNA binding	IDA	molecular function
GO:0008156	negative regulation of DNA replication	IDA	biological process
GO:0090734	site of DNA damage	IDA	cellular component
GO:0016887	ATPase activity	IDA	molecular function
GO:0043111	replication fork arrest	IDA	biological process
GO:0010942	positive regulation of cell death	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0051607	defense response to virus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0004386	helicase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0000049	tRNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0004521	endoribonuclease activity	IEA	molecular function
GO:0016078	tRNA catabolic process	IEA	biological process
GO:0016075	rRNA catabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)