• Gene id: 91603

Gene Summary

• Gene Symbol: ZNF830   Gene   UCSC   Ensembl
• Aliases: CCDC16, OMCG1
• Gene name: zinc finger protein 830
• Alternate names: zinc finger protein 830, coiled-coil domain containing 16, coiled-coil domain-containing protein 16, hypothetical protein MGC20398, orphan maintenance of genome 1,
• Gene location: 17q12 (34961539: 34963776)     Exons: 1     NC_000017.11

Protein Summary

• Protein general information: Q96NB3  
  • Name: Zinc finger protein 830 (Coiled coil domain containing protein 16)
  • Length: 372  
  • Mass: 41999
• Sequence:

  MASSASARTPAGKRVINQEELRRLMKEKQRLSTSRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHVLGKQH
  REKVAELKGAKEASQGSSASSAPHSVKRKAPDADDQDVKRAKATLVPQVQPSTSAWTTNFDKIGKEFIRATPSKP
  SGLSLLPDYEDEEEEEEEEEGDGERKRGDASKPLSDAQGKEHSVSSSREVTSSVLPNDFFSTNPPKAPIIPHSGS
  IEKAEIHEKVVERRENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGR
  LDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEILTIKELQKKEEENADSDDEGELQDLLSQDWRVKGALL

• Structural information:
  • Interpro: IPR003604  IPR040050  IPR036236  
  • Prosite: PS00028
  • DIP: 61544
  • STRING: ENSP00000354518
• Other Databases: GeneCards:  ZNF830  Malacards:  ZNF830

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0033260	nuclear DNA replication	IBA	biological process
GO:0033314	mitotic DNA replication checkpoint	IBA	biological process
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0044773	mitotic DNA damage checkpoint	IBA	biological process
GO:0048478	replication fork protection	IBA	biological process
GO:0048478	replication fork protection	ISS	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0001541	ovarian follicle development	ISS	biological process
GO:0033314	mitotic DNA replication checkpoint	ISS	biological process
GO:0001546	preantral ovarian follicle growth	ISS	biological process
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048478	replication fork protection	IEA	biological process
GO:0044773	mitotic DNA damage checkpoint	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0001541	ovarian follicle development	IEA	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0060729	intestinal epithelial structure maintenance	IEA	biological process
GO:0051276	chromosome organization	IEA	biological process
GO:0033314	mitotic DNA replication checkpoint	IEA	biological process
GO:0033260	nuclear DNA replication	IEA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001832	blastocyst growth	IEA	biological process
GO:0001546	preantral ovarian follicle growth	IEA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)