• Gene id: 9159

Gene Summary

• Gene Symbol: PCSK7   Gene   UCSC   Ensembl
• Aliases: LPC, PC7, PC8, SPC7
• Gene name: proprotein convertase subtilisin/kexin type 7
• Alternate names: proprotein convertase subtilisin/kexin type 7, lymphoma proprotein convertase, prohormone convertase 7, prohormone convertase PC7, proprotein convertase 7, proprotein convertase 8, proprotein convertase PC7, proprotein convertase subtilisin/kexin type 7 precurso,
• Gene location: 11q23.3 (117232524: 117201155)     Exons: 21     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. It encodes a type 1 membr

Protein Summary

• Protein general information: Q16549  
  • Name: Proprotein convertase subtilisin/kexin type 7 (EC 3.4.21. ) (Lymphoma proprotein convertase) (Prohormone convertase 7) (Proprotein convertase 7) (PC7) (Proprotein convertase 8) (PC8) (hPC8) (Subtilisin/kexin like protease PC7)
  • Length: 785  
  • Mass: 86247
  • Tissue specificity: Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocyte.
• Sequence:

  MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGTGGPSWAVHLESLEGDGEEETLEQQAD
  ALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAVLAGHEAVRWHSEQRLLRRAKRSVHFNDPKY
  PQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENG
  NHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP
  HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRMPFYAEECASMLAVTF
  SGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALMLQVRPCLTWRDVQHIIVFTATRYEDRRAEWV
  TNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVPYLASYVSPVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTL
  EHVAVTVSITHPRRGSLELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERARGTYRLVIRDVGDESF
  QVGILRQWQLTLYGSVWSAVDIRDRQRLLESAMSGKYLHDDFALPCPPGLKIPEEDGYTITPNTLKTLVLVGCFT
  VFWTVYYMLEVYLSQRNVASNQVCRSGPCHWPHRSRKAKEEGTELESVPLCSSKDPDEVETESRGPPTTSDLLAP
  DLLEQGDWSLSQNKSALDCPHQHLDVPHGKEEQIC

• Structural information:
  • Protein Domains: (153..47-)
    (/note="Peptidase-S8)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01240-)
    (481..61-)
    (/note="P/Homo-B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01173"-)
  • Interpro: IPR008979  IPR034182  IPR002884  IPR000209  IPR036852   IPR022398  IPR023828  IPR015500  IPR032815  IPR038466  
  • Prosite: PS51829 PS51892 PS00137 PS00138
  • CDD: cd04059
  • STRING: ENSP00000325917
• Other Databases: GeneCards:  PCSK7  Malacards:  PCSK7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0016485	protein processing	IBA	biological process
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016485	protein processing	IDA	biological process
GO:0008233	peptidase activity	IDA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030173	integral component of Golgi membrane	IDA	cellular component
GO:0016486	peptide hormone processing	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq