• Gene id: 91582

Gene Summary

• Gene Symbol: RPS19BP1   Gene   UCSC   Ensembl
• Aliases: AROS, S19BP
• Gene name: ribosomal protein S19 binding protein 1
• Alternate names: active regulator of SIRT1, 40S ribosomal protein S19-binding protein 1, RPS19-binding protein 1, homolog of mouse S19 binding protein,
• Gene location: 22q13.1 (39532747: 39529092)     Exons: 5     NC_000022.11
• OMIM: 610225

Protein Summary

• Protein general information: Q86WX3  
  • Name: Active regulator of SIRT1 (40S ribosomal protein S19 binding protein 1) (RPS19 binding protein 1) (S19BP)
  • Length: 136  
  • Mass: 15434
  • Tissue specificity: Widely expressed (at protein level). {ECO
• Sequence:

  MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVN
  LKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS

• Structural information:
  • Interpro: IPR023262  
  • STRING: ENSP00000333948
• Other Databases: GeneCards:  RPS19BP1  Malacards:  RPS19BP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019899	enzyme binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005654	nucleoplasm	ISS	cellular component
GO:0005730	nucleolus	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0019899	enzyme binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq