• Gene id: 9158

Gene Summary

• Gene Symbol: FIBP   Gene   UCSC   Ensembl
• Aliases: FGFIBP, FIBP-1, TROFAS
• Gene name: FGF1 intracellular binding protein
• Alternate names: acidic fibroblast growth factor intracellular-binding protein, aFGF intracellular-binding protein,
• Gene location: 11q13.1 (65888509: 65883739)     Exons: 10     NC_000011.10
• Gene summary(Entrez): Acidic fibroblast growth factor is mitogenic for a variety of different cell types and acts by stimulating mitogenesis or inducing morphological changes and differentiation. The FIBP protein is an intracellular protein that binds selectively to acidic fib
• OMIM: 608296

Protein Summary

• Protein general information: O43427  
  • Name: Acidic fibroblast growth factor intracellular binding protein (aFGF intracellular binding protein) (FGF 1 intracellular binding protein)
  • Length: 364  
  • Mass: 41878
  • Tissue specificity: Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.
• Sequence:

  MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPK
  LLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEE
  MRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVGEAPTDPDSQ
  MDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVR
  DLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD

• Structural information:
  • Interpro: IPR008614  
  • STRING: ENSP00000344572
• Other Databases: GeneCards:  FIBP  Malacards:  FIBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017134	fibroblast growth factor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0012505	endomembrane system	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0070527	platelet aggregation	HMP	biological process

Diseases

Associated diseases	References
Thauvin-Robinet-Faivre syndrome	KEGG:H02347
Thauvin-Robinet-Faivre syndrome	KEGG:H02347
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq