• Gene id: 91543

Gene Summary

• Gene Symbol: RSAD2   Gene   UCSC   Ensembl
• Aliases: 2510004L01Rik, cig33, cig5, vig1
• Gene name: radical S-adenosyl methionine domain containing 2
• Alternate names: radical S-adenosyl methionine domain-containing protein 2, cytomegalovirus-induced gene 5 protein, viperin, virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible,
• Gene location: 2p25.2 (3840958: 3826977)     Exons: 4     NC_000011.10
• OMIM: 607810

Protein Summary

• Protein general information: Q8WXG1  
  • Name: Radical S adenosyl methionine domain containing protein 2 (Cytomegalovirus induced gene 5 protein) (Viperin) (Virus inhibitory protein, endoplasmic reticulum associated, interferon inducible)
  • Length: 361  
  • Mass: 42170
• Sequence:

  MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSV
  NYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP
  SVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVIN
  RFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDS
  YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW

• Structural information:
  • Interpro: IPR013785  IPR006638  IPR007197  
  • STRING: ENSP00000371471
• Other Databases: GeneCards:  RSAD2  Malacards:  RSAD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051539	4 iron, 4 sulfur cluster binding	IDA	molecular function
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0050709	negative regulation of protein secretion	IDA	biological process
GO:0043621	protein self-association	IDA	molecular function
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0043367	CD4-positive, alpha-beta T cell differentiation	ISS	biological process
GO:0034157	positive regulation of toll-like receptor 7 signaling pathway	ISS	biological process
GO:0005811	lipid droplet	ISS	cellular component
GO:2000553	positive regulation of T-helper 2 cell cytokine production	ISS	biological process
GO:0035710	CD4-positive, alpha-beta T cell activation	ISS	biological process
GO:0034165	positive regulation of toll-like receptor 9 signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000553	positive regulation of T-helper 2 cell cytokine production	IEA	biological process
GO:0035710	CD4-positive, alpha-beta T cell activation	IEA	biological process
GO:0034165	positive regulation of toll-like receptor 9 signaling pathway	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045071	negative regulation of viral genome replication	IEA	biological process
GO:0043367	CD4-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0034157	positive regulation of toll-like receptor 7 signaling pathway	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0051607	defense response to virus	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0051607	defense response to virus	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05164	Influenza A
hsa05160	Hepatitis C

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881