• Gene id: 9154

Gene Summary

• Gene Symbol: SLC28A1   Gene   UCSC   Ensembl
• Aliases: CNT1, HCNT1, URCTU
• Gene name: solute carrier family 28 member 1
• Alternate names: sodium/nucleoside cotransporter 1, Na(+)/nucleoside cotransporter 1, concentrative nucleoside transporter 1, sodium-coupled nucleoside transporter 1, solute carrier family 28 (concentrative nucleoside transporter), member 1, solute carrier family 28 (sodium-co,
• Gene location: 15q25.3 (84884349: 84975648)     Exons: 29     NC_000015.10
• OMIM: 606207

Protein Summary

• Protein general information: O00337  
  • Name: Sodium/nucleoside cotransporter 1 (Concentrative nucleoside transporter 1) (CNT 1) (hCNT1) (Na(+)/nucleoside cotransporter 1) (Sodium coupled nucleoside transporter 1) (Solute carrier family 28 member 1)
  • Length: 649  
  • Mass: 71584
  • Tissue specificity: Expressed in kidney.
• Sequence:

  MENDPSRRRESISLTPVAKGLENMGADFLESLEEGQLPRSDLSPAEIRSSWSEAAPKPFSRWRNLQPALRARSFC
  REHMQLFRWIGTGLLCTGLSAFLLVACLLDFQRALALFVLTCVVLTFLGHRLLKRLLGPKLRRFLKPQGHPRLLL
  WFKRGLALAAFLGLVLWLSLDTSQRPEQLVSFAGICVFVALLFACSKHHCAVSWRAVSWGLGLQFVLGLLVIRTE
  PGFIAFEWLGEQIRIFLSYTKAGSSFVFGEALVKDVFAFQVLPIIVFFSCVISVLYHVGLMQWVILKIAWLMQVT
  MGTTATETLSVAGNIFVSQTEAPLLIRPYLADMTLSEVHVVMTGGYATIAGSLLGAYISFGIDATSLIAASVMAA
  PCALALSKLVYPEVEESKFRREEGVKLTYGDAQNLIEAASTGAAISVKVVANIAANLIAFLAVLDFINAALSWLG
  DMVDIQGLSFQLICSYILRPVAFLMGVAWEDCPVVAELLGIKLFLNEFVAYQDLSKYKQRRLAGAEEWVGDRKQW
  ISVRAEVLTTFALCGFANFSSIGIMLGGLTSMVPQRKSDFSQIVLRALFTGACVSLVNACMAGILYMPRGAEVDC
  MSLLNTTLSSSSFEIYQCCREAFQSVNPEFSPEALDNCCRFYNHTICAQ

• Structural information:
  • Interpro: IPR008276  IPR018270  IPR030212  IPR011657  IPR002668   IPR011642  
  • STRING: ENSP00000378074
• Other Databases: GeneCards:  SLC28A1  Malacards:  SLC28A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901642	nucleoside transmembrane transport	IDA	biological process
GO:0045117	azole transmembrane transport	IDA	biological process
GO:1901474	azole transmembrane transporter activity	IDA	molecular function
GO:0015213	uridine transmembrane transporter activity	IDA	molecular function
GO:0005345	purine nucleobase transmembrane transporter activity	NAS	molecular function
GO:0015212	cytidine transmembrane transporter activity	TAS	molecular function
GO:0015862	uridine transport	IDA	biological process
GO:0072531	pyrimidine-containing compound transmembrane transport	IDA	biological process
GO:1904823	purine nucleobase transmembrane transport	NAS	biological process
GO:0031526	brush border membrane	ISS	cellular component
GO:0015861	cytidine transport	TAS	biological process
GO:1901642	nucleoside transmembrane transport	IBA	biological process
GO:0015862	uridine transport	IBA	biological process
GO:0015855	pyrimidine nucleobase transport	IBA	biological process
GO:0015389	pyrimidine- and adenine-specific:sodium symporter activity	IBA	molecular function
GO:0005415	nucleoside:sodium symporter activity	IBA	molecular function
GO:0015861	cytidine transport	IBA	biological process
GO:0015293	symporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005337	nucleoside transmembrane transporter activity	IBA	molecular function
GO:0015862	uridine transport	IDA	biological process
GO:0015212	cytidine transmembrane transporter activity	IDA	molecular function
GO:0015213	uridine transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0015861	cytidine transport	IDA	biological process
GO:0005415	nucleoside:sodium symporter activity	IEA	molecular function
GO:1901642	nucleoside transmembrane transport	IEA	biological process
GO:0005337	nucleoside transmembrane transporter activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015858	nucleoside transport	TAS	biological process
GO:0005337	nucleoside transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005415	nucleoside:sodium symporter activity	TAS	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq