• Gene id: 9153

Gene Summary

• Gene Symbol: SLC28A2   Gene   UCSC   Ensembl
• Aliases: CNT2, HCNT2, HsT17153, SPNT1
• Gene name: solute carrier family 28 member 2
• Alternate names: sodium/nucleoside cotransporter 2, CNT 2, Na(+)/nucleoside cotransporter 2, SPNT, concentrative nucleoside transporter 2, sodium-coupled nucleoside transporter 2, sodium/purine nucleoside co-transporter, solute carrier family 28 (concentrative nucleoside transpo,
• Gene location: 15q21.1 (45252233: 45277845)     Exons: 18     NC_000015.10
• OMIM: 606208

Protein Summary

• Protein general information: O43868  
  • Name: Sodium/nucleoside cotransporter 2 (Concentrative nucleoside transporter 2) (CNT 2) (hCNT2) (Na(+)/nucleoside cotransporter 2) (Sodium coupled nucleoside transporter 2) (Sodium/purine nucleoside co transporter) (SPNT) (Solute carrier family 28 member 2)
  • Length: 658  
  • Mass: 71926
  • Tissue specificity: Expressed in heart and skeletal muscle followed by liver, kidney, intestine, pancreas, placenta and brain. Weak expression in lung.
• Sequence:

  MEKASGRQSIALSTVETGTVNPGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHAS
  LFKKILLGLLCLAYAAYLLAACILNFQRALALFVITCLVIFVLVHSFLKKLLGKKLTRCLKPFENSRLRLWTKWV
  FAGVSLVGLILWLALDTAQRPEQLIPFAGICMFILILFACSKHHSAVSWRTVFSGLGLQFVFGILVIRTDLGYTV
  FQWLGEQVQIFLNYTVAGSSFVFGDTLVKDVFAFQALPIIIFFGCVVSILYYLGLVQWVVQKVAWFLQITMGTTA
  TETLAVAGNIFVGMTEAPLLIRPYLGDMTLSEIHAVMTGGFATISGTVLGAFIAFGVDASSLISASVMAAPCALA
  SSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDI
  QGLTFQVICSYLLRPMVFMMGVEWTDCPMVAEMVGIKFFINEFVAYQQLSQYKNKRLSGMEEWIEGEKQWISVRA
  EIITTFSLCGFANLSSIGITLGGLTSIVPHRKSDLSKVVVRALFTGACVSLISACMAGILYVPRGAEADCVSFPN
  TSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA

• Structural information:
  • Interpro: IPR008276  IPR018270  IPR030212  IPR011657  IPR002668   IPR011642  
  • STRING: ENSP00000315006
• Other Databases: GeneCards:  SLC28A2  Malacards:  SLC28A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006836	neurotransmitter transport	IDA	biological process
GO:1901642	nucleoside transmembrane transport	IDA	biological process
GO:1901642	nucleoside transmembrane transport	IDA	biological process
GO:1904823	purine nucleobase transmembrane transport	IDA	biological process
GO:0035340	inosine transport	IDA	biological process
GO:0005326	neurotransmitter transmembrane transporter activity	IDA	molecular function
GO:0005415	nucleoside:sodium symporter activity	IDA	molecular function
GO:0015389	pyrimidine- and adenine-specific:sodium symporter activity	IDA	molecular function
GO:0015213	uridine transmembrane transporter activity	IDA	molecular function
GO:0015213	uridine transmembrane transporter activity	IDA	molecular function
GO:0005345	purine nucleobase transmembrane transporter activity	IDA	molecular function
GO:0015211	purine nucleoside transmembrane transporter activity	IDA	molecular function
GO:1901474	azole transmembrane transporter activity	ISS	molecular function
GO:0015860	purine nucleoside transmembrane transport	IDA	biological process
GO:0015862	uridine transport	IDA	biological process
GO:0015862	uridine transport	IDA	biological process
GO:0072531	pyrimidine-containing compound transmembrane transport	IDA	biological process
GO:0072531	pyrimidine-containing compound transmembrane transport	IDA	biological process
GO:0032238	adenosine transport	IDA	biological process
GO:0045117	azole transmembrane transport	ISS	biological process
GO:0012506	vesicle membrane	ISS	cellular component
GO:0030135	coated vesicle	ISS	cellular component
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0031526	brush border membrane	ISS	cellular component
GO:0001895	retina homeostasis	IBA	biological process
GO:0005415	nucleoside:sodium symporter activity	IBA	molecular function
GO:1901642	nucleoside transmembrane transport	IBA	biological process
GO:0005337	nucleoside transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015211	purine nucleoside transmembrane transporter activity	IBA	molecular function
GO:0015293	symporter activity	IBA	molecular function
GO:0005415	nucleoside:sodium symporter activity	IEA	molecular function
GO:1901642	nucleoside transmembrane transport	IEA	biological process
GO:0005337	nucleoside transmembrane transporter activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015211	purine nucleoside transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0015860	purine nucleoside transmembrane transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005415	nucleoside:sodium symporter activity	TAS	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015855	pyrimidine nucleobase transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881