• Gene id: 9150

Gene Summary

• Gene Symbol: CTDP1   Gene   UCSC   Ensembl
• Aliases: CCFDN, FCP1
• Gene name: CTD phosphatase subunit 1
• Alternate names: RNA polymerase II subunit A C-terminal domain phosphatase, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1, CTD of POLR2A, phosphatase of, subunit 1, TFIIF-associating CTD phosphatase 1, serine phosphatase FCP1a, transcri,
• Gene location: 18q23 (79679802: 79756624)     Exons: 15     NC_000018.10
• Gene summary(Entrez): This gene encodes a protein which interacts with the carboxy-terminus of the RAP74 subunit of transcription initiation factor TFIIF, and functions as a phosphatase that processively dephosphorylates the C-terminus of POLR2A (a subunit of RNA polymerase II
• OMIM: 153340

Protein Summary

• Protein general information: Q9Y5B0  
  • Name: RNA polymerase II subunit A C terminal domain phosphatase (EC 3.1.3.16) (TFIIF associating CTD phosphatase)
  • Length: 961  
  • Mass: 104399
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MEVPAAGRVPAEGAPTAAVAEVRCPGPAPLRLLEWRVAAGAAVRIGSVLAVFEAAASAQSSGASQSRVASGGCVR
  PARPERRLRSERAGVVRELCAQPGQVVAPGAVLVRLEGCSHPVVMKGLCAECGQDLTQLQSKNGKQQVPLSTATV
  SMVHSVPELMVSSEQAEQLGREDQQRLHRNRKLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRL
  RPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCI
  IDDREDVWKFAPNLITVKKYVYFQGTGDMNAPPGSRESQTRKKVNHSRGTEVSEPSPPVRDPEGVTQAPGVEPSN
  GLEKPARELNGSEAATPRDSPRPGKPDERDIWPPAQAPTSSQELAGAPEPQGSCAQGGRVAPGQRPAQGATGTDL
  DFDLSSDSESSSESEGTKSSSSASDGESEGKRGRQKPKAAPEGAGALAQGSSLEPGRPAAPSLPGEAEPGAHAPD
  KEPELGGQEEGERDGLCGLGNGCADRKEAETESQNSELSGVTAGESLDQSMEEEEEEDTDEDDHLIYLEEILVRV
  HTDYYAKYDRYLNKEIEEAPDIRKIVPELKSKVLADVAIIFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSP
  DAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDKVEEQLFPLRDDHTKAQRENSPAAFPDREGV
  PPTALFHPMPVLPKAQPGPEVRIYDSNTGKLIRTGARGPPAPSSSLPIRQEPSSFRAVPPPQPQMFGEELPDAQD
  GEQPGPSRRKRQPSMSETMPLYTLCKEDLESMDKEVDDILGEGSDDSDSEKRRPEEQEEEPQPRKPGTRRERTLG
  APASSERSAAGGRGPRGHKRKLNEEDAASESSRESSNEDEGSSSEADEMAKALEAELNDLM

• Structural information:
  • Protein Domains: (178..34-)
    (/note="FCP1-homology)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00336-)
    (629..72-)
    (/note="BRCT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00033"-)
  • Interpro: IPR001357  IPR036420  IPR039189  IPR015388  IPR004274   IPR011947  IPR036412  IPR023214  
  • Prosite: PS50172 PS50969
  • PDB: 1J2X 1ONV 2K7L
  • PDBsum: 1J2X 1ONV 2K7L
  • DIP: 41788
  • STRING: ENSP00000484525
• Other Databases: GeneCards:  CTDP1  Malacards:  CTDP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IBA	molecular function
GO:0070940	dephosphorylation of RNA polymerase II C-terminal domain	IBA	biological process
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IDA	molecular function
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0051233	spindle midzone	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0000922	spindle pole	IDA	cellular component
GO:0010458	exit from mitosis	IMP	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IEA	molecular function
GO:0070940	dephosphorylation of RNA polymerase II C-terminal domain	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0050434	positive regulation of viral transcription	TAS	biological process
GO:0004721	phosphoprotein phosphatase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061052	negative regulation of cell growth involved in cardiac muscle cell development	IEA	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IDA	molecular function
GO:0001096	TFIIF-class transcription factor complex binding	IPI	molecular function
GO:0001096	TFIIF-class transcription factor complex binding	IPI	molecular function
GO:0032991	protein-containing complex	IMP	cellular component
GO:0043923	positive regulation by host of viral transcription	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0030957	Tat protein binding	IPI	molecular function

Diseases

Associated diseases	References
Congenital cataracts, facial dysmorphism, and neuropathy	KEGG:H01220
Congenital cataracts, facial dysmorphism, and neuropathy	KEGG:H01220
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray