• Gene id: 91452

Gene Summary

• Gene Symbol: ACBD5   Gene   UCSC   Ensembl
• Aliases: RDLKD
• Gene name: acyl-CoA binding domain containing 5
• Alternate names: acyl-CoA-binding domain-containing protein 5, acyl-Coenzyme A binding domain containing 5, endozepine-related protein, membrane-associated diazepam binding inhibitor,
• Gene location: 10p12.1 (27243541: 27182837)     Exons: 18     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the acyl-Coenzyme A binding protein family, known to function in the transport and distribution of long chain acyl-Coenzyme A in cells. This gene may play a role in the differentiation of megakaryocytes and formation of plate
• OMIM: 616618

Protein Summary

• Protein general information: Q5T8D3  
  • Name: Acyl CoA binding domain containing protein 5
  • Length: 534  
  • Mass: 60092
• Sequence:

  MFQFHAGSWESWCCCCLIPADRPWDRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFY
  KQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVED
  KKSGRSSDITSVRLEKISKCLEDLGNVLTSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKS
  ADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQH
  LTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQVVAVEGKG
  EVKHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIA
  LVLMRLQEDMQNVLQRLQKLETLTALQAKSSTSTLQTAPQPTSQRPSWWPFEMSPGVLTFAIIWPFIAQWLVYLY
  YQRRRRKLN

• Structural information:
  • Protein Domains: (41..13-)
    (/note="ACB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00573"-)
  • Interpro: IPR016347  IPR022408  IPR000582  IPR035984  IPR014352  
  • Prosite: PS00880 PS51228
  • CDD: cd00435
  • PDB: 3FLV
  • PDBsum: 3FLV
  • STRING: ENSP00000379568
• Other Databases: GeneCards:  ACBD5  Malacards:  ACBD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005777	peroxisome	IDA	cellular component
GO:0016236	macroautophagy	IMP	NOT|biological process
GO:0035973	aggrephagy	IMP	NOT|biological process
GO:0030242	autophagy of peroxisome	IMP	biological process
GO:0000062	fatty-acyl-CoA binding	IEA	molecular function
GO:0030242	autophagy of peroxisome	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0009062	fatty acid catabolic process	TAS	biological process
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray