• Gene id: 9144

Gene Summary

• Gene Symbol: SYNGR2   Gene   UCSC   Ensembl
• Gene name: synaptogyrin 2
• Alternate names: synaptogyrin-2, cellugyrin,
• Gene location: 17q25.3 (78168544: 78172963)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may
• OMIM: 603593

Protein Summary

• Protein general information: O43760  
  • Name: Synaptogyrin 2 (Cellugyrin)
  • Length: 224  
  • Mass: 24810
  • Tissue specificity: Ubiquitous; low expression in brain. {ECO
• Sequence:

  MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIG
  VLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLVGADSVRAAIT
  FSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY

• Structural information:
  • Protein Domains: (20..17-)
    (/note="MARVEL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
  • Interpro: IPR008253  IPR016579  
  • Prosite: PS51225
  • STRING: ENSP00000225777
• Other Databases: GeneCards:  SYNGR2  Malacards:  SYNGR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031594	neuromuscular junction	IBA	cellular component
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0045055	regulated exocytosis	ISS	biological process
GO:0048499	synaptic vesicle membrane organization	ISS	biological process
GO:0030672	synaptic vesicle membrane	ISS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq