• Gene id: 9143

Gene Summary

• Gene Symbol: SYNGR3   Gene   UCSC   Ensembl
• Gene name: synaptogyrin 3
• Alternate names: synaptogyrin-3,
• Gene location: 16p13.3 (1989969: 1994274)     Exons: 4     NC_000016.10
• Gene summary(Entrez): This gene encodes an integral membrane protein. The exact function of this protein is unclear, but studies of a similar murine protein suggest that it is a synaptic vesicle protein that also interacts with the dopamine transporter. The gene product belong
• OMIM: 614150

Protein Summary

• Protein general information: O43761  
  • Name: Synaptogyrin 3
  • Length: 229  
  • Mass: 24555
  • Tissue specificity: Expressed in brain and placenta. {ECO
• Sequence:

  MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVFGPIVNEGYVNTDSGPELRCVFNGNAGACRFGVALG
  LGAFLACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFLWFVGFCFLTNQWQRTAPGPATTQAGDAARAAI
  AFSFFSILSWVALTVKALQRFRLGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPKGYQ
  VPAY

• Structural information:
  • Protein Domains: (20..17-)
    (/note="MARVEL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
  • Interpro: IPR008253  IPR016579  
  • Prosite: PS51225
  • STRING: ENSP00000248121
• Other Databases: GeneCards:  SYNGR3  Malacards:  SYNGR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031594	neuromuscular junction	IBA	cellular component
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0045055	regulated exocytosis	ISS	biological process
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0032411	positive regulation of transporter activity	ISS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0045055	regulated exocytosis	IEA	biological process
GO:0001504	neurotransmitter uptake	IEA	biological process
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0032411	positive regulation of transporter activity	IEA	biological process
GO:0042169	SH2 domain binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0021762	substantia nigra development	HEP	biological process
GO:0016021	integral component of membrane	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray