• Gene id: 9141

Gene Summary

• Gene Symbol: PDCD5   Gene   UCSC   Ensembl
• Aliases: TFAR19
• Gene name: programmed cell death 5
• Alternate names: programmed cell death protein 5, TF-1 cell apoptosis-related protein 19, TF1 cell apoptosis-related gene 19, TFAR19 novel apoptosis-related,
• Gene location: 19q13.11 (32581189: 32587452)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein that is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. The encoded protein may be an important regulator of K(lysine) acetyltransferase 5 (a protein involved in transcription, DNA
• OMIM: 604583

Protein Summary

• Protein general information: O14737  
  • Name: Programmed cell death protein 5 (TF 1 cell apoptosis related protein 19) (Protein TFAR19)
  • Length: 125  
  • Mass: 14285
  • Tissue specificity: Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.
• Sequence:

  MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLI
  QMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

• Structural information:
  • Interpro: IPR002836  IPR036883  
  • PDB: 1YYB 2CRU 2K6B
  • PDBsum: 1YYB 2CRU 2K6B
  • DIP: 50602
  • STRING: ENSP00000466214
• Other Databases: GeneCards:  PDCD5  Malacards:  PDCD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010698	acetyltransferase activator activity	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0071560	cellular response to transforming growth factor beta stimulus	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005737	cytoplasm	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1903645	negative regulation of chaperone-mediated protein folding	IMP	biological process
GO:0048487	beta-tubulin binding	IPI	molecular function
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IMP	biological process
GO:1903638	positive regulation of protein insertion into mitochondrial outer membrane	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)