• Gene id: 91404

Gene Summary

• Gene Symbol: SESTD1   Gene   UCSC   Ensembl
• Aliases: SOLO
• Gene name: SEC14 and spectrin domain containing 1
• Alternate names: SEC14 domain and spectrin repeat-containing protein 1, SEC14 and spectrin domains 1, huntingtin-interacting protein-like protein, protein Solo,
• Gene location: 2q31.2 (179264831: 179101677)     Exons: 20     NC_000002.12

Protein Summary

• Protein general information: Q86VW0  
  • Name: SEC14 domain and spectrin repeat containing protein 1 (Huntingtin interacting protein like protein) (Protein Solo)
  • Length: 696  
  • Mass: 79348
  • Tissue specificity: Broad expression. High expression in thalamus and brain. Significantly expressed in vasculature. {ECO
• Sequence:

  MEASVILPILKKKLAFLSGGKDRRSGLILTIPLCLEQTNMDELSVTLDYLLSIPSEKCKARGFTVIVDGRKSQWN
  VVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSLT
  YDHMDWLNKRLVFEKFTKESTSLLDELALINNGSDKGNQQEKERSVDLNFLPSVDPETVLQTGHELLSELQQRRF
  NGSDGGVSWSPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQW
  GIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAGDEEDLVELKSLQQQLSDVCYRQASQLEFRQN
  LLQAALEFHGVAQDLSQQLDGLLGMLCVDVAPADGASIQQTLKLLEEKLKSVDVGLQGLREKGQGLLDQISNQAS
  WAYGKDVTIENKENVDHIQGVMEDMQLRKQRCEDMVDVRRLKMLQMVQLFKCEEDAAQAVEWLSELLDALLKTHI
  RLGDDAQETKVLLEKHRKFVDVAQSTYDYGRQLLQATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTIASEERVHR
  LEMAIAFHSNAEKILQDCPEEPEAINDEEQFDEIEAVGKSLLDRLTVPVVYPDGTEQYFGSPSDMASTAENIRDR
  MKLVNLKRQQLRHPEMVTTES

• Structural information:
  • Protein Domains: (1..15-)
    (/note="CRAL-TRIO-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00056"-)
  • Interpro: IPR001251  
  • Prosite: PS50191
  • CDD: cd00170
  • STRING: ENSP00000415332
• Other Databases: GeneCards:  SESTD1  Malacards:  SESTD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034704	calcium channel complex	IPI	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0070300	phosphatidic acid binding	IDA	molecular function
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	IDA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IDA	molecular function
GO:0032266	phosphatidylinositol-3-phosphate binding	IDA	molecular function
GO:0005545	1-phosphatidylinositol binding	IDA	NOT|molecular function
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	IDA	molecular function
GO:0070273	phosphatidylinositol-4-phosphate binding	IDA	molecular function
GO:0031210	phosphatidylcholine binding	IDA	NOT|molecular function
GO:0010314	phosphatidylinositol-5-phosphate binding	IDA	molecular function
GO:0001786	phosphatidylserine binding	IDA	NOT|molecular function
GO:1904878	negative regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)