• Gene id: 9140

Gene Summary

• Gene Symbol: ATG12   Gene   UCSC   Ensembl
• Aliases: APG12, APG12L, FBR93, HAPG12
• Gene name: autophagy related 12
• Alternate names: ubiquitin-like protein ATG12, APG12 autophagy 12-like, ATG12 autophagy related 12 homolog, Apg12 (autophagy, yeast) homolog,
• Gene location: 5q22.3 (115841564: 115828199)     Exons: 6     NC_000005.10
• Gene summary(Entrez): Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog o
• OMIM: 609608

Protein Summary

• Protein general information: O94817  
  • Name: Ubiquitin like protein ATG12 (Autophagy related protein 12) (APG12 like)
  • Length: 140  
  • Mass: 15113
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAV
  ERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

• Structural information:
  • Interpro: IPR007242  IPR029071  
  • PDB: 4GDK 4GDL 4NAW
  • PDBsum: 4GDK 4GDL 4NAW
  • DIP: 46466
  • STRING: ENSP00000425107
• Other Databases: GeneCards:  ATG12  Malacards:  ATG12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044804	autophagy of nucleus	IBA	biological process
GO:0034045	phagophore assembly site membrane	IBA	cellular component
GO:0006501	C-terminal protein lipidation	IBA	biological process
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0000045	autophagosome assembly	IBA	biological process
GO:0034274	Atg12-Atg5-Atg16 complex	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000045	autophagosome assembly	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0034045	phagophore assembly site membrane	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0034045	phagophore assembly site membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034045	phagophore assembly site membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04621	NOD-like receptor signaling pathway
hsa04140	Autophagy - animal
hsa04068	FoxO signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)