• Gene id: 914

Gene Summary

• Gene Symbol: CD2   Gene   UCSC   Ensembl
• Aliases: LFA-2, SRBC, T11
• Gene name: CD2 molecule
• Alternate names: T-cell surface antigen CD2, CD2 antigen (p50), sheep red blood cell receptor, LFA-3 receptor, T-cell surface antigen T11/Leu-5, erythrocyte receptor, lymphocyte-function antigen-2, rosette receptor,
• Gene location: 1p13.1 (116754429: 116769228)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a surface antigen found on all peripheral blood T-cells. The encoded protein interacts with LFA3 (CD58) on antigen presenting cells to optimize immune recognition. A locus control region (LCR) has been found in the 3' f
• OMIM: 616251

Protein Summary

• Protein general information: P06729  
  • Name: T cell surface antigen CD2 (Erythrocyte receptor) (LFA 2) (LFA 3 receptor) (Rosette receptor) (T cell surface antigen T11/Leu 5) (CD antigen CD2)
  • Length: 351  
  • Mass: 39448
• Sequence:

  MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEK
  ETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTLTCEVMN
  GTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMV
  FVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP
  GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN

• Structural information:
  • Protein Domains: (25..12-)
    (/note="Ig-like-V-type)
    (129..20-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR015632  IPR036179  IPR013783  IPR008424  IPR013106  
  • PDB: 1CDB 1GYA 1HNF 1L2Z 1QA9 2J6O 2J7I
  • PDBsum: 1CDB 1GYA 1HNF 1L2Z 1QA9 2J6O 2J7I
  • STRING: ENSP00000358490
• Other Databases: GeneCards:  CD2  Malacards:  CD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0042110	T cell activation	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0043621	protein self-association	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034113	heterotypic cell-cell adhesion	IDA	biological process
GO:1902715	positive regulation of interferon-gamma secretion	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0045580	regulation of T cell differentiation	NAS	biological process
GO:0042110	T cell activation	TAS	biological process
GO:0001766	membrane raft polarization	TAS	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IMP	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0030887	positive regulation of myeloid dendritic cell activation	NAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030101	natural killer cell activation	NAS	biological process
GO:0098609	cell-cell adhesion	NAS	biological process
GO:0038023	signaling receptor activity	NAS	molecular function
GO:0001766	membrane raft polarization	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0042110	T cell activation	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0043621	protein self-association	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034113	heterotypic cell-cell adhesion	IDA	biological process
GO:1902715	positive regulation of interferon-gamma secretion	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0045580	regulation of T cell differentiation	NAS	biological process
GO:0042110	T cell activation	TAS	biological process
GO:0001766	membrane raft polarization	TAS	biological process
GO:2000484	positive regulation of interleukin-8 secretion	IMP	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0030887	positive regulation of myeloid dendritic cell activation	NAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030101	natural killer cell activation	NAS	biological process
GO:0098609	cell-cell adhesion	NAS	biological process
GO:0038023	signaling receptor activity	NAS	molecular function
GO:0001766	membrane raft polarization	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881