About Us

Search Result


Gene id 91355
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol LRP5L   Gene   UCSC   Ensembl
Gene name LDL receptor related protein 5 like
Alternate names low-density lipoprotein receptor-related protein 5-like protein, LRP-5-like, low density lipoprotein receptor-related protein 5-like,
Gene location 22q11.23 (25405409: 25351417)     Exons: 9     NC_000022.11
OMIM 617997

Protein Summary

Protein general information A4QPB2  

Name: Low density lipoprotein receptor related protein 5 like protein (LRP 5 like)

Length: 252  Mass: 28483

Sequence MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKILVSED
MDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEAISV
DETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLKAVNVDKVVGTNPHAD
RNGGAATCASSRPTQPGLAAPSRAWNC
Structural information
Interpro:  IPR011042  IPR000033  
Prosite:   PS51120
MINT:  
STRING:   ENSP00000482378
Other Databases GeneCards:  LRP5L  Malacards:  LRP5L

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0002076 osteoblast development
IBA biological process
GO:0005886 plasma membrane
IBA cellular component
GO:0015026 coreceptor activity
IBA molecular function
GO:0017147 Wnt-protein binding
IBA molecular function
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
IBA biological process
GO:0046849 bone remodeling
IBA biological process
GO:0060070 canonical Wnt signaling p
athway
IBA biological process
GO:0060349 bone morphogenesis
IBA biological process
GO:0060444 branching involved in mam
mary gland duct morphogen
esis
IBA biological process
GO:0061178 regulation of insulin sec
retion involved in cellul
ar response to glucose st
imulus
IBA biological process
GO:0061304 retinal blood vessel morp
hogenesis
IBA biological process
GO:0001702 gastrulation with mouth f
orming second
IBA biological process
GO:0009952 anterior/posterior patter
n specification
IBA biological process
GO:0042632 cholesterol homeostasis
IBA biological process
GO:0042813 Wnt-activated receptor ac
tivity
IBA molecular function
GO:0043235 receptor complex
IBA cellular component
GO:0048539 bone marrow development
IBA biological process
GO:0060612 adipose tissue developmen
t
IBA biological process
Associated diseases References
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract