• Gene id: 9134

Gene Summary

• Gene Symbol: CCNE2   Gene   UCSC   Ensembl
• Aliases: CYCE2
• Gene name: cyclin E2
• Alternate names: G1/S-specific cyclin-E2,
• Gene location: 8q22.1 (94896670: 94880223)     Exons: 15     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
• OMIM: 300265

Protein Summary

• Protein general information: O96020  
  • Name: G1/S specific cyclin E2
  • Length: 404  
  • Mass: 46757
  • Tissue specificity: According to PubMed
• Sequence:

  MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETP
  HKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLL
  EVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILR
  MELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA
  LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINT
  FRKGGQLSPVCNGGIMTPPKSTEKPPGKH

• Structural information:
  • Interpro: IPR039361  IPR013763  IPR036915  IPR004367  IPR028858   IPR006671  
  • Prosite: PS00292
  • CDD: cd00043
  • DIP: 31733
  • STRING: ENSP00000429089
• Other Databases: GeneCards:  CCNE2  Malacards:  CCNE2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044772	mitotic cell cycle phase transition	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IBA	cellular component
GO:0000082	G1/S transition of mitotic cell cycle	IBA	biological process
GO:0097135	cyclin E2-CDK2 complex	IBA	cellular component
GO:0097134	cyclin E1-CDK2 complex	IBA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IEA	biological process
GO:0042025	host cell nucleus	IEA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000723	telomere maintenance	IEA	biological process
GO:0007129	synapsis	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0070192	chromosome organization involved in meiotic cell cycle	IEA	biological process
GO:1903827	regulation of cellular protein localization	IEA	biological process
GO:0006270	DNA replication initiation	IEA	biological process
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IEA	molecular function
GO:0097135	cyclin E2-CDK2 complex	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0097135	cyclin E2-CDK2 complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa05166	Human T-cell leukemia virus 1 infection
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa05162	Measles
hsa05222	Small cell lung cancer
hsa05215	Prostate cancer
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Laryngeal cancer	KEGG:H00055
Laryngeal cancer	KEGG:H00055
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881