• Gene id: 9133

Gene Summary

• Gene Symbol: CCNB2   Gene   UCSC   Ensembl
• Aliases: HsT17299
• Gene name: cyclin B2
• Alternate names: G2/mitotic-specific cyclin-B2,
• Gene location: 15q22.2 (59105084: 59125044)     Exons: 9     NC_000015.10
• Gene summary(Entrez): Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyc
• OMIM: 602755

Protein Summary

• Protein general information: O95067  
  • Name: G2/mitotic specific cyclin B2
  • Length: 398  
  • Mass: 45,282
• Sequence:

  MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPT
  ASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQS
  INPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEM
  FSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
  VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLK
  ISMIPQLNSKAVKDLASPLIGRS

• Structural information:
  • Interpro: IPR013763  IPR036915  IPR004367  IPR006671  
  • Prosite: PS00292
  • CDD: cd00043
  • DIP: 31730
  • STRING: ENSP00000288207
• Other Databases: GeneCards:  CCNB2  Malacards:  CCNB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0040007	growth	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0048538	thymus development	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0040007	growth	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0048538	thymus development	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0051726	regulation of cell cycle	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04068	FoxO signaling pathway
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa04115	p53 signaling pathway
hsa04218	Cellular senescence
hsa04914	Progesterone-mediated oocyte maturation
hsa05166	Human T-cell leukemia virus 1 infection
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Male factor infertility	MIK: 16155078
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 16155078
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16155078	Male infertility			37 azoospermic patients	Male infertility	CDC2 CCNB1 CCNB2 CDC25A CDC25B CDC25C and WEE1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R