• Gene id: 91272

Gene Summary

• Gene Symbol: BOD1   Gene   UCSC   Ensembl
• Aliases: FAM44B
• Gene name: biorientation of chromosomes in cell division 1
• Alternate names: biorientation of chromosomes in cell division protein 1, biorientation defective 1, family with sequence similarity 44, member B,
• Gene location: 5q35.2 (173617071: 173607144)     Exons: 2     NC_000005.10
• OMIM: 616745

Protein Summary

• Protein general information: Q96IK1  
  • Name: Biorientation of chromosomes in cell division protein 1 (Biorientation defective protein 1) (Protein FAM44B)
  • Length: 185  
  • Mass: 19196
• Sequence:

  MADGGGGGGTGAVGGGGTSQASAGAATGATGASGGGGPINPASLPPGDPQLIALIVEQLKSRGLFDSFRRDCLAD
  VDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIE
  RAIHEFLAAQKKAAVPAPPPEPEGQDPPAPSQDTS

• Structural information:
  • Interpro: IPR026955  
  • STRING: ENSP00000309644
• Other Databases: GeneCards:  BOD1  Malacards:  BOD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IBA	cellular component
GO:0004864	protein phosphatase inhibitor activity	IBA	molecular function
GO:0000940	condensed chromosome outer kinetochore	IBA	cellular component
GO:0051721	protein phosphatase 2A binding	IBA	molecular function
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IBA	biological process
GO:0005876	spindle microtubule	IBA	cellular component
GO:0000922	spindle pole	IBA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IDA	biological process
GO:0004864	protein phosphatase inhibitor activity	IDA	molecular function
GO:0000922	spindle pole	IDA	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0000940	condensed chromosome outer kinetochore	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0051721	protein phosphatase 2A binding	IPI	molecular function
GO:0051721	protein phosphatase 2A binding	IPI	molecular function
GO:1990758	mitotic sister chromatid biorientation	IMP	biological process
GO:0071459	protein localization to chromosome, centromeric region	IMP	biological process
GO:0071962	mitotic sister chromatid cohesion, centromeric	IMP	biological process
GO:0071459	protein localization to chromosome, centromeric region	IMP	biological process
GO:1990758	mitotic sister chromatid biorientation	IMP	biological process
GO:0007080	mitotic metaphase plate congression	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)