• Gene id: 9125

Gene Summary

• Gene Symbol: CNOT9   Gene   UCSC   Ensembl
• Aliases: CAF40, CT129, RCD-1, RCD1, RQCD1
• Gene name: CCR4-NOT transcription complex subunit 9
• Alternate names: CCR4-NOT transcription complex subunit 9, RCD1 required for cell differentiation1 homolog, cancer/testis antigen 129, cell differentiation protein RCD1 homolog, cell differentiation protein RQCD1 homolog, protein involved in sexual development,
• Gene location: 2q35 (218568577: 218597079)     Exons: 32     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the highly conserved RCD1 protein family. The encoded protein is a transcriptional cofactor and a core protein of the CCR4-NOT complex. It may be involved in signal transduction as well as retinoic acid-regulated cell differe
• OMIM: 612054

Protein Summary

• Protein general information: Q92600  
  • Name: CCR4 NOT transcription complex subunit 9 (Cell differentiation protein RQCD1 homolog) (Rcd 1)
  • Length: 299  
  • Mass: 33631
  • Tissue specificity: Detected in spleen, thymus, prostate, testis, ovary and intestine. {ECO
• Sequence:

  MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYP
  SINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVKTD
  EQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQLSKEPS
  ARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQVLKDDTTTKRWLAQLVKNLQEGQVTDPRGIPLPPQ

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR007216  
  • PDB: 2FV2 4CRU 4CRV 4CT6 4CT7 5LSW 5ONA 5ONB 6HOM 6HON
  • PDBsum: 2FV2 4CRU 4CRV 4CT6 4CT7 5LSW 5ONA 5ONB 6HOM 6HON
  • DIP: 46840
  • STRING: ENSP00000273064
• Other Databases: GeneCards:  CNOT9  Malacards:  CNOT9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000932	P-body	IBA	cellular component
GO:0017148	negative regulation of translation	IBA	biological process
GO:0030015	CCR4-NOT core complex	IBA	cellular component
GO:0030014	CCR4-NOT complex	IDA	cellular component
GO:2000327	positive regulation of nuclear receptor transcription coactivator activity	IDA	biological process
GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway	IMP	biological process
GO:0000932	P-body	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030014	CCR4-NOT complex	IEA	cellular component
GO:0006402	mRNA catabolic process	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007548	sex differentiation	TAS	biological process
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0005154	epidermal growth factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881