• Gene id: 9121

Gene Summary

• Gene Symbol: SLC16A5   Gene   UCSC   Ensembl
• Aliases: MCT5, MCT6
• Gene name: solute carrier family 16 member 5
• Alternate names: monocarboxylate transporter 6, monocarboxylate transporter 5, solute carrier family 16 (monocarboxylate transporter), member 5, solute carrier family 16 (monocarboxylic acid transporters), member 5, solute carrier family 16, member 5 (monocarboxylic acid tran,
• Gene location: 17q25.1 (75087764: 75106161)     Exons: 8     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the monocarboxylate transporter family and the major facilitator superfamily. The encoded protein is localized to the cell membrane and acts as a proton-linked transporter of bumetanide. Transport by the encoded protein is in
• OMIM: 603879

Protein Summary

• Protein general information: O15375  
  • Name: Monocarboxylate transporter 6 (MCT 6) (Monocarboxylate transporter 5) (MCT 5) (Solute carrier family 16 member 5)
  • Length: 505  
  • Mass: 54994
  • Tissue specificity: Highly expressed in kidney.
• Sequence:

  MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVG
  RFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLANALASMGVSL
  GITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPETPALGCLAACGRTIQR
  HLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISIIGFSNIFLRPLAGLMAGRPAF
  ASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIFQVLMDIVPMDQFPRALGLFTVLDGL
  AFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQKKEQGKQAVAADALERDLFLEAKDGPGKQR
  SPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT

• Structural information:
  • Interpro: IPR004743  IPR030760  IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000390564
• Other Databases: GeneCards:  SLC16A5  Malacards:  SLC16A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015718	monocarboxylic acid transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0008028	monocarboxylic acid transmembrane transporter activity	IBA	molecular function
GO:0008028	monocarboxylic acid transmembrane transporter activity	IEA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0015718	monocarboxylic acid transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008028	monocarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0015718	monocarboxylic acid transport	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq