• Gene id: 91151

Gene Summary

• Gene Symbol: TIGD7   Gene   UCSC   Ensembl
• Aliases: Sancho
• Gene name: tigger transposable element derived 7
• Alternate names: tigger transposable element-derived protein 7,
• Gene location: 16p13.3 (3305429: 3298807)     Exons: 2     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposa
• OMIM: 612969

Protein Summary

• Protein general information: Q6NT04  
  • Name: Tigger transposable element derived protein 7
  • Length: 549  
  • Mass: 63236
  • Tissue specificity: Expressed in all tissues tested. Higher expression in testis and ovary. {ECO
• Sequence:

  MNKRGKYTTLNLEEKMKVLSRIEAGRSLKSVMDEFGISKSTFYDIKKNKKLILDFVLKQDMPLVGAEKRKRTTGA
  KYGDVDDAVYMWYQQKRSAGVPVRGVELQAAAERFARCFGRTDFKASTGWLFRFRNRHAIGNRKGCGEQVLSSVS
  ENVEPFRQKLSMIIKEEKLCLAQLYSGDETDLFWKSMPENSQASRKDICLPGKKINKERLSAFLCANADGTHKLK
  SIIIGKSKLPKSVKEDTSTLPVIYKPSKDVWFTRELFSEWFFQNFVPEVRHFQLNVLRFHDEDVRALLLLDSCPA
  HPSSESLTSEDGRIKCMFFPHNTSTLIQPMNQGVILSCKRLYRWKQLEESLVIFEESDDEQEKGDKGVSKIKIYN
  IKSAIFNWAKSWEEVKQITIANAWENLLYKKEPEYDFQGLEHGDYREILEKCGELETKLDDDRVWLNGDEEKGCL
  LKTKGGITKEVVQKGGEAEKQTAEFKLSAVRESLDYLLDFVDATPEFQRFHFTLKEMQQEIVKKQFQSKIHSRIG
  SFLKPRPHNIKDSFSGPSTSGSNH

• Structural information:
  • Protein Domains: (1..5-)
    (/note="HTH-psq-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00320-)
    (68..13-)
    (/note="HTH-CENPB-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00583-)
    (169..39-)
    (/note="DDE-1-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR004875  IPR009057  IPR006600  IPR007889  IPR036388  
  • Prosite: PS51253 PS50960
  • STRING: ENSP00000380071
• Other Databases: GeneCards:  TIGD7  Malacards:  TIGD7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq