• Gene id: 911

Gene Summary

• Gene Symbol: CD1C   Gene   UCSC   Ensembl
• Aliases: BDCA1, CD1, CD1A, R7
• Gene name: CD1c molecule
• Alternate names: T-cell surface glycoprotein CD1c, CD1C antigen, c polypeptide, cortical thymocyte antigen CD1C, differentiation antigen CD1-alpha-3,
• Gene location: 1q23.1 (42021370: 41976420)     Exons: 19     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation o
• OMIM: 188340

Protein Summary

• Protein general information: P29017  
  • Name: T cell surface glycoprotein CD1c (CD antigen CD1c)
  • Length: 333  
  • Mass: 37654
  • Tissue specificity: Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
• Sequence:

  MLFLQFLLLALLLPGGDNADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGN
  FSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWV
  PSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVC
  HASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHF
  SMNWIALVVIVPLVILIVLVLWFKKHCSYQDIL

• Structural information:
  • Protein Domains: (206..29-)
    (/note="Ig-like"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003597  IPR011161   IPR037055  IPR011162  
  • Prosite: PS50835
  • PDB: 3OV6 4ONO 5C9J 6C09 6C15
  • PDBsum: 3OV6 4ONO 5C9J 6C09 6C15
  • STRING: ENSP00000357152
• Other Databases: GeneCards:  CD1C  Malacards:  CD1C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071723	lipopeptide binding	IBA	molecular function
GO:0030884	exogenous lipid antigen binding	IBA	molecular function
GO:0030883	endogenous lipid antigen binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0048007	antigen processing and presentation, exogenous lipid antigen via MHC class Ib	IBA	biological process
GO:0048006	antigen processing and presentation, endogenous lipid antigen via MHC class Ib	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0001916	positive regulation of T cell mediated cytotoxicity	IBA	biological process
GO:0071723	lipopeptide binding	IDA	molecular function
GO:0051861	glycolipid binding	IDA	molecular function
GO:0030884	exogenous lipid antigen binding	IDA	molecular function
GO:0030883	endogenous lipid antigen binding	IDA	molecular function
GO:0002286	T cell activation involved in immune response	IDA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa05146	Amoebiasis
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)