• Gene id: 91039

Gene Summary

• Gene Symbol: DPP9   Gene   UCSC   Ensembl
• Aliases: DP9, DPLP9, DPP IX, DPRP-2, DPRP2
• Gene name: dipeptidyl peptidase 9
• Alternate names: dipeptidyl peptidase 9, dipeptidyl peptidase IV-related protein-2, dipeptidyl peptidase IX, dipeptidyl peptidase-like protein 9,
• Gene location: 19p13.3 (4723841: 4675225)     Exons: 27     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein that is a member of the S9B family in clan SC of the serine proteases. The protein has been shown to have post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Although the
• OMIM: 610305

Protein Summary

• Protein general information: Q86TI2  
  • Name: Dipeptidyl peptidase 9 (DP9) (EC 3.4.14.5) (Dipeptidyl peptidase IV related protein 2) (DPRP 2) (Dipeptidyl peptidase IX) (DPP IX) (Dipeptidyl peptidase like protein 9) (DPLP9)
  • Length: 863  
  • Mass: 98263
  • Tissue specificity: Ubiquitously expressed, with highest levels in liver, heart and muscle, and lowest levels in brain. {ECO
• Sequence:

  MATTGTPTADRGDAAATDDPAARFQVQKHSWDGLRSIIHGSRKYSGLIVNKAPHDFQFVQKTDESGPHSHRLYYL
  GMPYGSRENSLLYSEIPKKVRKEALLLLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGITSYDFHSESGL
  FLFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLWVANIETGEERRLTFC
  HQGLSNVLDDPKSAGVATFVIQEEFDRFTGYWWCPTASWEGSEGLKTLRILYEEVDESEVEVIHVPSPALEERKT
  DSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSSLFPKVEYIARAGWTRDGKYAWAMFLDRPQQW
  LQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPQSEGEDELCFLRANECKTG
  FCHLYKVTAVLKSQGYDWSEPFSPGEDEFKCPIKEEIALTSGEWEVLARHGSKIWVNEETKLVYFQGTKDTPLEH
  HLYVVSYEAAGEIVRLTTPGFSHSCSMSQNFDMFVSHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAAS
  CPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVV
  VIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVA
  IAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVSQLIR
  AGKPYQLQIYPNERHSIRCPESGEHYEVTLLHFLQEYL

• Structural information:
  • Interpro: IPR029058  IPR001375  IPR002469  IPR038554  
  • PDB: 6EOQ 6EOR
  • PDBsum: 6EOQ 6EOR
  • STRING: ENSP00000262960
• Other Databases: GeneCards:  DPP9  Malacards:  DPP9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005874	microtubule	IDA	cellular component
GO:0031252	cell leading edge	IDA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0004177	aminopeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R