• Gene id: 9103

Gene Summary

• Gene Symbol: FCGR2C   Gene   UCSC   Ensembl
• Aliases: CD32, CD32C, CDW32, FCG2, FCRIIC, IGFR2
• Gene name: Fc fragment of IgG receptor IIc (gene/pseudogene)
• Alternate names: low affinity immunoglobulin gamma Fc region receptor II-c, Fc fragment of IgG, low affinity IIc, receptor for (CD32), Fc gamma receptor IIC, IgG Fc receptor II-c, fc-gamma-RIIc, immunoglobulin G Fc receptor II-c,
• Gene location: 1q23.3 (161581338: 161601219)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing o

Protein Summary

• Protein general information: P31995  
  • Name: Low affinity immunoglobulin gamma Fc region receptor II c (IgG Fc receptor II c) (CDw32) (Fc gamma RII c) (Fc gamma RIIc) (FcRII c) (CD antigen CD32)
  • Length: 323  
  • Mass: 35578
  • Tissue specificity: Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.
• Sequence:

  MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTH
  SPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVL
  RCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGII
  VAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPR
  APTDDDKNIYLTLPPNDHVNSNN

• Structural information:
  • Protein Domains: (48..12-)
    1 (/note="Ig-like-C2-type)
    (131..21-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598  
  • Prosite: PS50835
  • PDB: 3WJL
  • PDBsum: 3WJL
• Other Databases: GeneCards:  FCGR2C  Malacards:  FCGR2C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050776	regulation of immune response	IBA	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0019864	IgG binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	NAS	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0006955	immune response	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04380	Osteoclast differentiation
hsa05150	Staphylococcus aureus infection
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Immune thrombocytopenia	KEGG:H01240
Immune thrombocytopenia	KEGG:H01240
Unexplained infertility	MIK: 25753583
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R