• Gene id: 9100

Gene Summary

• Gene Symbol: USP10   Gene   UCSC   Ensembl
• Aliases: UBPO
• Gene name: ubiquitin specific peptidase 10
• Alternate names: ubiquitin carboxyl-terminal hydrolase 10, deubiquitinating enzyme 10, ubiquitin specific protease 10, ubiquitin thioesterase 10, ubiquitin thiolesterase 10, ubiquitin-specific-processing protease 10,
• Gene location: 16q24.1 (84699976: 84779921)     Exons: 19     NC_000016.10
• Gene summary(Entrez): Ubiquitin is a highly conserved protein that is covalently linked to other proteins to regulate their function and degradation. This gene encodes a member of the ubiquitin-specific protease family of cysteine proteases. The enzyme specifically cleaves ubi
• OMIM: 616673

Protein Summary

• Protein general information: Q14694  
  • Name: Ubiquitin carboxyl terminal hydrolase 10 (EC 3.4.19.12) (Deubiquitinating enzyme 10) (Ubiquitin thioesterase 10) (Ubiquitin specific processing protease 10)
  • Length: 798  
  • Mass: 87134
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQRIEFGVDEVIEPSDTLPRTP
  SYSISSTLNPQAPEFILGCTASKITPDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGVSGGLGQRERK
  KKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPPSVTPRTCNSPQNSTDSVSDIVPD
  SPFPGALGSDTRTAGQPEGGPGADFGQSCFPAEAGRDTLSRTAGAQPCVGTDTTENLGVANGQILESSGEGTATN
  GVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSKPSSSSPVAYVETKYSPPAISPLVSE
  KQVEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRGLINKGNWCYINATLQALVACPPMYHLMKFIPLYS
  KVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKIVRDIRPGAAFEPTYIYRLLTVNKSSLSEKGRQEDAE
  EYLGFILNGLHEEMLNLKKLLSPSNEKLTISNGPKNHSVNEEEQEEQGEGSEDEWEQVGPRNKTSVTRQADFVQT
  PITGIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQEVEISRRVTL
  EKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHY
  TTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRVDLL

• Structural information:
  • Protein Domains: (415..79-)
    (/note="USP"-)
  • Interpro: IPR009818  IPR038765  IPR001394  IPR018200  IPR028889  
  • Prosite: PS00972 PS00973 PS50235
  • STRING: ENSP00000457411
• Other Databases: GeneCards:  USP10  Malacards:  USP10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010506	regulation of autophagy	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IBA	biological process
GO:0016579	protein deubiquitination	IBA	biological process
GO:0005769	early endosome	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004197	cysteine-type endopeptidase activity	IBA	molecular function
GO:0044325	ion channel binding	IDA	molecular function
GO:0010506	regulation of autophagy	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0016579	protein deubiquitination	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IMP	molecular function
GO:0002039	p53 binding	IPI	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IMP	molecular function
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IMP	biological process
GO:0016579	protein deubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IMP	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IMP	molecular function
GO:0004197	cysteine-type endopeptidase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071347	cellular response to interleukin-1	IMP	biological process
GO:0016579	protein deubiquitination	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016579	protein deubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019985	translesion synthesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq