Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 9099
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol USP2   Gene   UCSC   Ensembl
Aliases UBP41, USP9
Gene name ubiquitin specific peptidase 2
Alternate names ubiquitin carboxyl-terminal hydrolase 2, 41 kDa ubiquitin-specific protease, deubiquitinating enzyme 2, ubiquitin specific protease 12, ubiquitin specific protease 9, ubiquitin thioesterase 2, ubiquitin-specific-processing protease 2,
Gene location 11q23.3 (119381689: 119355214)     Exons: 2     NC_000011.10
Gene summary(Entrez) This gene encodes a member of the family of de-ubiquitinating enzymes, which belongs to the peptidase C19 superfamily. The encoded protein is a ubiquitin-specific protease which is required for TNF-alpha (tumor necrosis factor alpha) -induced NF-kB (nucle
OMIM 604725

Protein Summary
Protein general information O75604  

Name: Ubiquitin carboxyl terminal hydrolase 2 (EC 3.4.19.12) (41 kDa ubiquitin specific protease) (Deubiquitinating enzyme 2) (Ubiquitin thioesterase 2) (Ubiquitin specific processing protease 2)

Length: 605  Mass: 68072

Tissue specificity: Expressed in mesangial cells of the kidney and in different types of glomerulonephritides (at protein level). {ECO

Sequence MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYD
RGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDF
SSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIIS
PTYRPIGRYTLWETGKGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLY
MRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNR
VTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGY
PEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRD
LDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELAS
PPSRM
Structural information
Protein Domains
 (267..59-)
(/note="USP"-)
Interpro:  IPR038765  IPR001394  IPR018200  IPR028889  
Prosite:   PS00972 PS00973 PS50235

PDB:  		 2HD5 2IBI 3NHE 3V6C 3V6E 5XU8 5XVE 6DGF
PDBsum:   2HD5 2IBI 3NHE 3V6C 3V6E 5XU8 5XVE 6DGF

DIP:  
29134
MINT:  
STRING:   ENSP00000260187
Other Databases GeneCards:  USP2  Malacards:  USP2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005737 cytoplasm
 IBA cellular component
GO:0050821 protein stabilization
 IDA biological process
GO:0016579 protein deubiquitination
 IDA biological process
GO:0016579 protein deubiquitination
 IDA biological process
GO:0048512 circadian behavior
 ISS biological process
GO:0045475 locomotor rhythm
 ISS biological process
GO:0043153 entrainment of circadian
clock by photoperiod
 ISS biological process
GO:0004843 thiol-dependent ubiquitin
-specific protease activi
ty
 IMP molecular function
GO:0050821 protein stabilization
 IMP biological process
GO:0045931 positive regulation of mi
totic cell cycle
 IMP biological process
GO:0031625 ubiquitin protein ligase
binding
 IPI molecular function
GO:0032922 circadian regulation of g
ene expression
 ISS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0030332 cyclin binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000122 negative regulation of tr
anscription by RNA polyme
rase II
 IMP biological process
GO:0006511 ubiquitin-dependent prote
in catabolic process
 IEA biological process
GO:0016579 protein deubiquitination
 IEA biological process
GO:0036459 thiol-dependent ubiquitin
yl hydrolase activity
 IEA molecular function
GO:0008233 peptidase activity
 IEA molecular function
GO:0048511 rhythmic process
 IEA biological process
GO:0006508 proteolysis
 IEA biological process
GO:0007517 muscle organ development
 IEA biological process
GO:0016787 hydrolase activity
 IEA molecular function
GO:0046872 metal ion binding
 IEA molecular function
GO:0007049 cell cycle
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0016020 membrane
 IEA cellular component
GO:0008234 cysteine-type peptidase a
ctivity
 IEA molecular function
GO:0004197 cysteine-type endopeptida
se activity
 TAS molecular function
GO:0036459 thiol-dependent ubiquitin
yl hydrolase activity
 IEA molecular function
GO:0004843 thiol-dependent ubiquitin
-specific protease activi
ty
 IDA molecular function
GO:0016579 protein deubiquitination
 IDA biological process
GO:0016579 protein deubiquitination
 TAS biological process
GO:0036459 thiol-dependent ubiquitin
yl hydrolase activity
 TAS molecular function
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0048512 circadian behavior
 IEA biological process
GO:0045475 locomotor rhythm
 IEA biological process
GO:0043153 entrainment of circadian
clock by photoperiod
 IEA biological process
GO:0005813 centrosome
 IEA cellular component
GO:0004843 thiol-dependent ubiquitin
-specific protease activi
ty
 IEA molecular function
GO:0042802 identical protein binding
 IEA molecular function
GO:0032922 circadian regulation of g
ene expression
 IEA biological process
GO:0016579 protein deubiquitination
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0016579 protein deubiquitination
 IEA biological process
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0016020 membrane
 IEA cellular component

Diseases

Expand All | Collapse All
Associated diseases References
Non obstructive azoospermia MIK: 24012201
Sertoli cell only syndrome MIK: 23869807
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
24012201 Non obstru
ctive azoo
spermia
31 (4 controls,
27 cases)
 Male infertility GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
23869807 Non obstru
ctive azoo
spermia, S
ertoli cel
l only syn
drome
20 (4 controls,
16 cases)
 Male infertility GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
31037746 Spermatoge
nic defect
s
28 men with az
oospermia
 Male infertility Microarray
 Show abstract