• Gene id: 90952

Gene Summary

• Gene Symbol: ESAM   Gene   UCSC   Ensembl
• Aliases: W117m
• Gene name: endothelial cell adhesion molecule
• Alternate names: endothelial cell-selective adhesion molecule, 2310008D05Rik, HUEL (C4orf1)-interacting protein, LP4791 protein,
• Gene location: 11q24.2 (124762289: 124753125)     Exons: 7     NC_000011.10
• OMIM: 609076

Protein Summary

• Protein general information: Q96AP7  
  • Name: Endothelial cell selective adhesion molecule
  • Length: 390  
  • Mass: 41176
  • Tissue specificity: Highly expressed in endothelial cells. {ECO
• Sequence:

  MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFF
  KQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVL
  VPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCK
  AHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKS
  SDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGA
  VPVMVPAQSQAGSLV

• Structural information:
  • Protein Domains: (30..14-)
    (/note="Ig-like-V-type)
    (153..24-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR042757  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000278927
• Other Databases: GeneCards:  ESAM  Malacards:  ESAM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000249	regulation of actin cytoskeleton reorganization	IDA	biological process
GO:0098632	cell-cell adhesion mediator activity	IDA	molecular function
GO:0098609	cell-cell adhesion	IDA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030833	regulation of actin filament polymerization	IDA	biological process
GO:0034613	cellular protein localization	IDA	biological process
GO:0035633	maintenance of blood-brain barrier	NAS	biological process
GO:0070830	bicellular tight junction assembly	IMP	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:2000249	regulation of actin cytoskeleton reorganization	IDA	biological process
GO:0098632	cell-cell adhesion mediator activity	IDA	molecular function
GO:0098609	cell-cell adhesion	IDA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030833	regulation of actin filament polymerization	IDA	biological process
GO:0034613	cellular protein localization	IDA	biological process
GO:0035633	maintenance of blood-brain barrier	NAS	biological process
GO:0070830	bicellular tight junction assembly	IMP	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04670	Leukocyte transendothelial migration

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881