• Gene id: 90871

Gene Summary

• Gene Symbol: DMAC1   Gene   UCSC   Ensembl
• Aliases: C9orf123, TMEM261
• Gene name: distal membrane arm assembly complex 1
• Alternate names: distal membrane-arm assembly complex protein 1, transmembrane protein 261, transmembrane protein C9orf123,
• Gene location: 9p24.1 (7799777: 7796499)     Exons: 2     NC_000009.12
• OMIM: 617261

Protein Summary

• Protein general information: Q96GE9  
  • Name: Distal membrane arm assembly complex protein 1 (Transmembrane protein 261)
  • Length: 116  
  • Mass: 12257
• Sequence:

  MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMGAGGYVYWVARKPMKM
  GYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV

• Structural information:
  • Interpro: IPR028036  
  • STRING: ENSP00000350961
• Other Databases: GeneCards:  DMAC1  Malacards:  DMAC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005747	mitochondrial respiratory chain complex I	IBA	colocalizes with
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005747	mitochondrial respiratory chain complex I	IDA	colocalizes with
GO:0032981	mitochondrial respiratory chain complex I assembly	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)