• Gene id: 9087

Gene Summary

• Gene Symbol: TMSB4Y   Gene   UCSC   Ensembl
• Aliases: TB4Y
• Gene name: thymosin beta 4 Y-linked
• Alternate names: thymosin beta-4, Y-chromosomal, thymosin beta-4, Y isoform, thymosin, beta 4, Y chromosome,
• Gene location: Yq11.221 (13703898: 13706023)     Exons: 2     NC_000024.10
• Gene summary(Entrez): This gene lies within the male specific region of chromosome Y. Its homolog on chromosome X escapes X inactivation and encodes an actin sequestering protein. [provided by RefSeq, Jul 2008]
• OMIM: 400017

Protein Summary

• Protein general information: O14604  
  • Name: Thymosin beta 4, Y chromosomal
  • Length: 44  
  • Mass: 5013
  • Tissue specificity: Ubiquitous.
• Sequence:

  MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES

• Structural information:
  • Interpro: IPR001152  IPR038386  
  • Prosite: PS00500
• Other Databases: GeneCards:  TMSB4Y  Malacards:  TMSB4Y

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042989	sequestering of actin monomers	IBA	biological process
GO:0030334	regulation of cell migration	IBA	biological process
GO:0003785	actin monomer binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0003785	actin monomer binding	IEA	molecular function
GO:0007015	actin filament organization	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0008064	regulation of actin polymerization or depolymerization	TAS	biological process
GO:0042989	sequestering of actin monomers	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)