• Gene id: 90865

Gene Summary

• Gene Symbol: IL33   Gene   UCSC   Ensembl
• Aliases: C9orf26, DVS27, IL1F11, NF-HEV, NFEHEV
• Gene name: interleukin 33
• Alternate names: interleukin-33, DVS27-related protein, interleukin-1 family member 11, nuclear factor for high endothelial venules, nuclear factor from high endothelial venules,
• Gene location: 9p24.1 (6214590: 6257982)     Exons: 11     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript vari
• OMIM: 608678

Protein Summary

• Protein general information: O95760  
  • Name: Interleukin 33 (IL 33) (Interleukin 1 family member 11) (IL 1F11) (Nuclear factor from high endothelial venules) (NF HEV) [Cleaved into: Interleukin 33 (95 270); Interleukin 33 (99 270); Interleukin 33 (109 270)]
  • Length: 270  
  • Mass: 30,759
• Sequence:

  MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRK
  HKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDL
  KKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHS
  NCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

• Structural information:
  • Interpro: IPR026145  
  • PDB: 2KLL 4KC3
  • PDBsum: 2KLL 4KC3
  • DIP: 37862
  • STRING: ENSP00000370842
• Other Databases: GeneCards:  IL33  Malacards:  IL33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002686	negative regulation of leukocyte migration	IEA	biological process
GO:0002826	negative regulation of T-helper 1 type immune response	IEA	biological process
GO:0002830	positive regulation of type 2 immune response	IEA	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0030133	transport vesicle	IEA	cellular component
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0032689	negative regulation of interferon-gamma production	IEA	biological process
GO:0032736	positive regulation of interleukin-13 production	IEA	biological process
GO:0032753	positive regulation of interleukin-4 production	IEA	biological process
GO:0032754	positive regulation of interleukin-5 production	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0042092	type 2 immune response	IBA	biological process
GO:0043032	positive regulation of macrophage activation	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0050729	positive regulation of inflammatory response	IBA	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IEA	biological process
GO:0051025	negative regulation of immunoglobulin secretion	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0090197	positive regulation of chemokine secretion	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0002686	negative regulation of leukocyte migration	IEA	biological process
GO:0002826	negative regulation of T-helper 1 type immune response	IEA	biological process
GO:0002830	positive regulation of type 2 immune response	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0030133	transport vesicle	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0032689	negative regulation of interferon-gamma production	IEA	biological process
GO:0032736	positive regulation of interleukin-13 production	IEA	biological process
GO:0032753	positive regulation of interleukin-4 production	IEA	biological process
GO:0032754	positive regulation of interleukin-5 production	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0042092	type 2 immune response	IBA	biological process
GO:0043032	positive regulation of macrophage activation	IEA	biological process
GO:0043032	positive regulation of macrophage activation	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IBA	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IEA	biological process
GO:0051025	negative regulation of immunoglobulin secretion	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0090197	positive regulation of chemokine secretion	IEA	biological process
GO:0090197	positive regulation of chemokine secretion	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0042092	type 2 immune response	IBA	biological process
GO:0043032	positive regulation of macrophage activation	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0050729	positive regulation of inflammatory response	IBA	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0090197	positive regulation of chemokine secretion	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04217	Necroptosis
hsa04623	Cytosolic DNA-sensing pathway
hsa05164	Influenza A

Diseases

Associated diseases	References
Myocardial Infarction	GAD: 19198610
Asthma	GAD: 19198610
Alzheimer's disease	GAD: 19204726
Alzheimer's disease	GAD: 19204726
Female infertility	INFBASE: 25977120
Endometriosis	MIK: 22587998
Nasal polyposis	GAD: 19860791
Endometriosis	MIK: 22587998
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22587998	Endometriosis
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R