About Us

Search Result


Gene id 9086
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol EIF1AY   Gene   UCSC   Ensembl
Aliases eIF-4C
Gene name eukaryotic translation initiation factor 1A Y-linked
Alternate names eukaryotic translation initiation factor 1A, Y-chromosomal, eIF-1A Y isoform, eukaryotic translation initiation factor 1A, Y chromosome, eukaryotic translation initiation factor 4C,
Gene location Yq11.223 (20575710: 20593153)     Exons: 7     NC_000024.10
Gene summary(Entrez) This gene is located on the non-recombining region of the Y chromosome. It encodes a protein related to eukaryotic translation initiation factor 1A (EIF1A), which may function in stabilizing the binding of the initiator Met-tRNA to 40S ribosomal subunits.
OMIM 400014

SNPs


rs13447352

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000024.10   g.20587967A>C
NC_000024.9   g.22749853A>C|SEQ=[A/C]|GENE=EIF1AY

Protein Summary

Protein general information O14602  

Name: Eukaryotic translation initiation factor 1A, Y chromosomal (eIF 1A Y isoform) (Eukaryotic translation initiation factor 4C) (eIF 4C)

Length: 144  Mass: 16442

Tissue specificity: Ubiquitous.

Sequence MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSD
IILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Structural information
Protein Domains
(22..9-)
(/note="S1-like"-)
Interpro:  IPR012340  IPR006196  IPR001253  IPR018104  
Prosite:   PS01262 PS50832
CDD:   cd05793
Other Databases GeneCards:  EIF1AY  Malacards:  EIF1AY

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0003723 RNA binding
IEA molecular function
GO:0006413 translational initiation
IEA biological process
GO:0006412 translation
IEA biological process
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0006413 translational initiation
IEA biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa03013RNA transport
Associated diseases References
Hypospermatogenesis MIK: 28361989
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract