• Gene id: 90843

Gene Summary

• Gene Symbol: TCEAL8   Gene   UCSC   Ensembl
• Aliases: WEX3
• Gene name: transcription elongation factor A like 8
• Alternate names: transcription elongation factor A protein-like 8, TCEA-like protein 8, transcription elongation factor A (SII)-like 8, transcription elongation factor S-II protein-like 8,
• Gene location: Xq22.1 (103255192: 103252994)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.

Protein Summary

• Protein general information: Q8IYN2  
  • Name: Transcription elongation factor A protein like 8 (TCEA like protein 8) (Transcription elongation factor S II protein like 8)
  • Length: 117  
  • Mass: 13616
• Sequence:

  MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEM
  IRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP

• Structural information:
  • Interpro: IPR021156  
  • STRING: ENSP00000361770
• Other Databases: GeneCards:  TCEAL8  Malacards:  TCEAL8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050699	WW domain binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray