• Gene id: 908

Gene Summary

• Gene Symbol: CCT6A   Gene   UCSC   Ensembl
• Aliases: CCT-zeta, CCT-zeta-1, CCT6, Cctz, HTR3, MoDP-2, TCP-1-zeta, TCP20, TCPZ, TTCP20
• Gene name: chaperonin containing TCP1 subunit 6A
• Alternate names: T-complex protein 1 subunit zeta, T-complex protein 1, zeta subunit, acute morphine dependence related protein 2, amino acid transport defect-complementing, chaperonin containing T-complex subunit 6, chaperonin containing TCP1, subunit 6A (zeta 1), histidine tr,
• Gene location: 7p11.2 (73522292: 73440405)     Exons: 21     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different p
• OMIM: 104613

SNPs

rs852977

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000005.10   g.143307929A>G
NC_000005.9   g.142687494A>G
NG_009062.1   g.132584T>C|SEQ=[A/G]|GENE=NR3C1

rs143136847

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.82354560T>C
NC_000012.12   g.82354560T>G
NC_000012.11   g.82748339T>C
NC_000012.11   g.82748339T>G
NG_053173.1   g.1155T>C
NG_053173.1   g.1155T>G
NG_053173.2   g.1155T>C
NG_053173.2   g.1155T>G
NM_014167.5   c.499A>G
NM_014167.5   c.499A>C
NM_014167.4  

rs13447352

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000024.10   g.20587967A>C
NC_000024.9   g.22749853A>C|SEQ=[A/C]|GENE=EIF1AY

Protein Summary

• Protein general information: P40227  
  • Name: T complex protein 1 subunit zeta (TCP 1 zeta) (Acute morphine dependence related protein 2) (CCT zeta 1) (HTR3) (Tcp20)
  • Length: 531  
  • Mass: 58024
• Sequence:

  MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMQIQHPTAS
  LIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVSREMDRETLID
  VARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRV
  EDAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPF
  SLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKFTFIEKCNNPRSVTLL
  IKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAEALIKHKPSVKGRAQLGVQAFADALLIIPKV
  LAQNSGFDLQETLVKIQAEHSESGQLVGVDLNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAG
  MSSLKG

• Structural information:
  • Interpro: IPR012722  IPR017998  IPR002194  IPR002423  IPR027409   IPR027413  IPR027410  
  • Prosite: PS00750 PS00751 PS00995
  • CDD: cd03342
  • PDB: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • PDBsum: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • DIP: 33558
  • STRING: ENSP00000275603
• Other Databases: GeneCards:  CCT6A  Malacards:  CCT6A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005832	chaperonin-containing T-complex	IBA	cellular component
GO:0005832	chaperonin-containing T-complex	IDA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0050821	protein stabilization	IMP	biological process
GO:0071987	WD40-repeat domain binding	IPI	molecular function
GO:0005832	chaperonin-containing T-complex	TAS	cellular component
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904871	positive regulation of protein localization to Cajal body	HMP	biological process
GO:1904874	positive regulation of telomerase RNA localization to Cajal body	HMP	biological process
GO:1904851	positive regulation of establishment of protein localization to telomere	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881