• Gene id: 9079

Gene Summary

• Gene Symbol: LDB2   Gene   UCSC   Ensembl
• Aliases: CLIM1, LDB-2, LDB1
• Gene name: LIM domain binding 2
• Alternate names: LIM domain-binding protein 2, LIM binding domain 2, LIM domain-binding factor CLIM1, LIM domain-binding factor-2, carboxyl-terminal LIM domain-binding protein 1,
• Gene location: 4p15.32 (16898808: 16501533)     Exons: 17     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the LIM-domain binding family. Members of this family are characterized by a conserved nuclear localization sequence, an amino-terminal homodimerization domain and a carboxy-terminal LIM interaction domain. Thes
• OMIM: 617208

Protein Summary

• Protein general information: O43679  
  • Name: LIM domain binding protein 2 (LDB 2) (Carboxyl terminal LIM domain binding protein 1) (CLIM 1) (LIM domain binding factor CLIM1)
  • Length: 373  
  • Mass: 42793
• Sequence:

  MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGP
  KRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMFTKVCTEGRLILEFTFD
  DLMRIKTWHFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNL
  SPRDCLKTCLFQKWQRMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVM
  VVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQETKSENPPPQASQ

• Structural information:
  • Interpro: IPR030174  IPR041363  IPR029005  
  • DIP: 24262 41215
  • STRING: ENSP00000306772
• Other Databases: GeneCards:  LDB2  Malacards:  LDB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0030274	LIM domain binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0007399	nervous system development	IBA	biological process
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0001102	RNA polymerase II activating transcription factor binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0043549	regulation of kinase activity	ISS	biological process
GO:0030334	regulation of cell migration	ISS	biological process
GO:0031252	cell leading edge	ISS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030274	LIM domain binding	IEA	molecular function
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003712	transcription coregulator activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044089	positive regulation of cellular component biogenesis	IEA	biological process
GO:0043549	regulation of kinase activity	IEA	biological process
GO:0030334	regulation of cell migration	IEA	biological process
GO:0010669	epithelial structure maintenance	IEA	biological process
GO:0001942	hair follicle development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0035019	somatic stem cell population maintenance	IEA	biological process
GO:0031252	cell leading edge	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0030274	LIM domain binding	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq