• Gene id: 90737

Gene Summary

• Gene Symbol: PAGE5   Gene   UCSC   Ensembl
• Aliases: CT16, CT16.1, CT16.2, GAGEE1, PAGE-5
• Gene name: PAGE family member 5
• Alternate names: P antigen family member 5, P antigen family, member 5 (prostate associated), cancer/testis antigen 16.1, cancer/testis antigen family 16, member 1, cancer/testis antigen family 16, member 2, g antigen family E member 1, prostate-associated gene 5 protein,
• Gene location: Xp11.21 (55220345: 55224107)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene is a member of family of proteins that are expressed in a variety of tumors and in some fetal and reproductive tissues. The encoded protein may protect cells from programmed cell death. Multiple alternatively spliced transcript variants encoding
• OMIM: 603941

Protein Summary

• Protein general information: Q96GU1  
  • Name: P antigen family member 5 (PAGE 5) (Cancer/testis antigen 16.1) (CT16.1) (G antigen family E member 1) (Prostate associated gene 5 protein)
  • Length: 130  
  • Mass: 14046
• Sequence:

  MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAPSGEIK
  NEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL

• Structural information:
  • Interpro: IPR031320  IPR008625  
  • STRING: ENSP00000289619
• Other Databases: GeneCards:  PAGE5  Malacards:  PAGE5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray