• Gene id: 90701

Gene Summary

• Gene Symbol: SEC11C   Gene   UCSC   Ensembl
• Aliases: SEC11L3, SPC21, SPCS4C
• Gene name: SEC11 homolog C, signal peptidase complex subunit
• Alternate names: signal peptidase complex catalytic subunit SEC11C, SEC11-like 3, SEC11-like protein 3, SPase 21 kDa subunit, microsomal signal peptidase 21 kDa subunit, signal peptidase complex 21,
• Gene location: 18q21.32 (27710772: 27756303)     Exons: 9     NC_000012.12

Protein Summary

• Protein general information: Q9BY50  
  • Name: Signal peptidase complex catalytic subunit SEC11C (EC 3.4.21.89) (Microsomal signal peptidase 21 kDa subunit) (SPase 21 kDa subunit) (SEC11 homolog C) (SEC11 like protein 3) (SPC21)
  • Length: 192  
  • Mass: 21542
• Sequence:

  MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHR
  GDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDV
  VGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES

• Structural information:
  • Interpro: IPR036286  IPR019758  IPR019756  IPR015927  IPR001733   IPR037710  
  • Prosite: PS00501 PS00761
  • STRING: ENSP00000468633
• Other Databases: GeneCards:  SEC11C  Malacards:  SEC11C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008233	peptidase activity	IBA	molecular function
GO:0006465	signal peptide processing	IBA	biological process
GO:0005787	signal peptidase complex	IBA	cellular component
GO:0005787	signal peptidase complex	IEA	cellular component
GO:0006465	signal peptide processing	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881