• Gene id: 9068

Gene Summary

• Gene Symbol: ANGPTL1   Gene   UCSC   Ensembl
• Aliases: ANG3, ANGPT3, ARP1, AngY, UNQ162, dJ595C2.2
• Gene name: angiopoietin like 1
• Alternate names: angiopoietin-related protein 1, ANG-3, angioarrestin, angiopoietin 3, angiopoietin Y1, angiopoietin-like protein 1, dJ595C2.2 (angiopoietin Y1),
• Gene location: 1q25.2 (178871076: 178849534)     Exons: 19     NC_000001.11
• Gene summary(Entrez): Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The p
• OMIM: 603874

Protein Summary

• Protein general information: O95841  
  • Name: Angiopoietin related protein 1 (Angiopoietin 3) (ANG 3) (Angiopoietin like protein 1)
  • Length: 491  
  • Mass: 56720
  • Tissue specificity: Highly expressed in adrenal gland, placenta, thyroid gland, heart, skeletal muscle and small intestine. Weakly expressed in testis, ovary, colon, pancreas, kidney and stomach. {ECO
• Sequence:

  MKTFTWTLGVLFFLLVDTGHCRGGQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDAST
  IKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLE
  LSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPN
  SQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPEN
  SNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWS
  DKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNL
  NGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPID

• Structural information:
  • Protein Domains: (271..49-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR036056  IPR002181  IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • STRING: ENSP00000234816
• Other Databases: GeneCards:  ANGPTL1  Malacards:  ANGPTL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0001525	angiogenesis	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)