• Gene id: 9066

Gene Summary

• Gene Symbol: SYT7   Gene   UCSC   Ensembl
• Aliases: IPCA-7, IPCA7, PCANAP7, SYT-VII, SYTVII
• Gene name: synaptotagmin 7
• Alternate names: synaptotagmin-7, prostate cancer-associated protein 7, synaptotagmin VII,
• Gene location: 11q12.2 (61588403: 61513713)     Exons: 18     NC_000011.10
• Gene summary(Entrez): This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. A similar protein in rodents mediates hormone secretio
• OMIM: 610933

Protein Summary

• Protein general information: O43581  
  • Name: Synaptotagmin 7 (IPCA 7) (Prostate cancer associated protein 7) (Synaptotagmin VII) (SytVII)
  • Length: 403  
  • Mass: 45501
  • Tissue specificity: Expressed in a variety of adult and fetal tissues.
• Sequence:

  MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRSEKKAIKLPA
  GGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQES
  TLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLD
  YDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGG
  TSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKIYLSWK
  SGPGEVKHWKDMIARPRQPVAQWHQLKA

• Structural information:
  • Protein Domains: (135..25-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (266..39-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR037732  IPR037741  IPR001565   IPR015427  
  • Prosite: PS50004
  • CDD: cd08386 cd08405
  • PDB: 2D8K
  • PDBsum: 2D8K
  • STRING: ENSP00000444201
• Other Databases: GeneCards:  SYT7  Malacards:  SYT7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005544	calcium-dependent phospholipid binding	NAS	molecular function
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0017158	regulation of calcium ion-dependent exocytosis	IBA	biological process
GO:0017156	calcium-ion regulated exocytosis	IBA	biological process
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0014059	regulation of dopamine secretion	IBA	biological process
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0005509	calcium ion binding	IBA	molecular function
GO:0001786	phosphatidylserine binding	IBA	molecular function
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0030276	clathrin binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0000149	SNARE binding	IBA	molecular function
GO:0032009	early phagosome	ISS	cellular component
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0005764	lysosome	ISS	cellular component
GO:0005544	calcium-dependent phospholipid binding	ISS	molecular function
GO:0005516	calmodulin binding	ISS	molecular function
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	ISS	biological process
GO:0036465	synaptic vesicle recycling	ISS	biological process
GO:0006909	phagocytosis	ISS	biological process
GO:1990926	short-term synaptic potentiation	ISS	biological process
GO:1990927	calcium ion regulated lysosome exocytosis	ISS	biological process
GO:0005777	peroxisome	ISS	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	ISS	molecular function
GO:0001778	plasma membrane repair	ISS	biological process
GO:1990927	calcium ion regulated lysosome exocytosis	ISS	biological process
GO:0090385	phagosome-lysosome fusion	ISS	biological process
GO:0090119	vesicle-mediated cholesterol transport	ISS	biological process
GO:0070092	regulation of glucagon secretion	ISS	biological process
GO:0050796	regulation of insulin secretion	ISS	biological process
GO:0050764	regulation of phagocytosis	ISS	biological process
GO:0046850	regulation of bone remodeling	ISS	biological process
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0006887	exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045956	positive regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0031045	dense core granule	IEA	cellular component
GO:0017158	regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0017156	calcium-ion regulated exocytosis	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0099502	calcium-dependent activation of synaptic vesicle fusion	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	IEA	biological process
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0036465	synaptic vesicle recycling	IEA	biological process
GO:0032009	early phagosome	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0017158	regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0014059	regulation of dopamine secretion	IEA	biological process
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0006909	phagocytosis	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005544	calcium-dependent phospholipid binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:1990926	short-term synaptic potentiation	IEA	biological process
GO:1990927	calcium ion regulated lysosome exocytosis	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0050796	regulation of insulin secretion	IEA	biological process
GO:0030276	clathrin binding	IEA	molecular function
GO:0019905	syntaxin binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0001778	plasma membrane repair	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0090385	phagosome-lysosome fusion	IEA	biological process
GO:0090119	vesicle-mediated cholesterol transport	IEA	biological process
GO:0070092	regulation of glucagon secretion	IEA	biological process
GO:0050796	regulation of insulin secretion	IEA	biological process
GO:0050764	regulation of phagocytosis	IEA	biological process
GO:0046850	regulation of bone remodeling	IEA	biological process
GO:0043679	axon terminus	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0001778	plasma membrane repair	IEA	biological process
GO:0000149	SNARE binding	IEA	molecular function
GO:1990927	calcium ion regulated lysosome exocytosis	IEA	biological process
GO:1900242	regulation of synaptic vesicle endocytosis	IEA	biological process
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq