• Gene id: 90655

Gene Summary

• Gene Symbol: TGIF2LY   Gene   UCSC   Ensembl
• Aliases: TGIFLY
• Gene name: TGFB induced factor homeobox 2 like, Y-linked
• Alternate names: homeobox protein TGIF2LY, TGF-beta-induced transcription factor 2-like protein, TGFB-induced factor 2-like protein, Y-linked, TGFB-induced factor 2-like, Y-linked, TGIF-like on the Y,
• Gene location: Yp11.2 (3579084: 3580040)     Exons: 2     NC_000024.10
• Gene summary(Entrez): This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. This gene lies within the male specific region of chromosome Y, in a block of sequence that is thought to be the result of a large X-to-Y transposition. The C-terminus o
• OMIM: 400025

Protein Summary

• Protein general information: Q8IUE0  
  • Name: Homeobox protein TGIF2LY (TGF beta induced transcription factor 2 like protein) (TGFB induced factor 2 like protein, Y linked) (TGIF like on the Y)
  • Length: 185  
  • Mass: 20,814
• Sequence:

  MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFK
  AYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPVV
  QTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE

• Structural information:
  • Interpro: IPR009057  IPR001356  IPR008422  
  • Prosite: PS50071
  • CDD: cd00086
  • STRING: ENSP00000318502
• Other Databases: GeneCards:  TGIF2LY  Malacards:  TGIF2LY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Azoospermia	MIK: 18384077
Azoospermia	MIK: 18384077
Male infertility	MIK: 18384077

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18384077	Azoospermia, male infertility			with nonobstructive azoospermia	Male infertility	TGIFLX TGIFLY