• Gene id: 90637

Gene Summary

• Gene Symbol: ZFAND2A   Gene   UCSC   Ensembl
• Aliases: AIRAP
• Gene name: zinc finger AN1-type containing 2A
• Alternate names: AN1-type zinc finger protein 2A, arsenite inducible RNA associated protein, zinc finger, AN1-type domain 2A,
• Gene location: 7p22.3 (1160195: 1148849)     Exons: 12     NC_000007.14
• OMIM: 610699

Protein Summary

• Protein general information: Q8N6M9  
  • Name: AN1 type zinc finger protein 2A
  • Length: 145  
  • Mass: 16477
• Sequence:

  MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLCNTPIPVKKGQIPDVV
  VGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG

• Structural information:
  • Interpro: IPR035896  IPR000058  
  • Prosite: PS51039
  • STRING: ENSP00000314619
• Other Databases: GeneCards:  ZFAND2A  Malacards:  ZFAND2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0000502	proteasome complex	IEA	cellular component
GO:0071243	cellular response to arsenic-containing substance	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray