• Gene id: 9063

Gene Summary

• Gene Symbol: PIAS2   Gene   UCSC   Ensembl
• Aliases: ARIP3, DIP, MIZ1, PIASX, SIZ2, ZMIZ4
• Gene name: protein inhibitor of activated STAT 2
• Alternate names: E3 SUMO-protein ligase PIAS2, DAB2-interacting protein, E3 SUMO-protein transferase PIAS2, androgen receptor-interacting protein 3, msx-interacting zinc finger protein, protein inhibitor of activated STAT X, zinc finger, MIZ-type containing 4,
• Gene location: 18q21.1 (46920166: 46803217)     Exons: 23     NC_000018.10
• Gene summary(Entrez): This gene encodes a member of the protein inhibitor of activated STAT family, which function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. Alternatively spliced transcript variants
• OMIM: 603567

Protein Summary

• Protein general information: O75928  
  • Name: E3 SUMO protein ligase PIAS2 (EC 2.3.2. ) (Androgen receptor interacting protein 3) (ARIP3) (DAB2 interacting protein) (DIP) (E3 SUMO protein transferase PIAS2) (Msx interacting zinc finger protein) (Miz1) (PIAS NY protein) (Protein inhibitor of activated
  • Length: 621  
  • Mass: 68240
  • Tissue specificity: Mainly expressed in testis. Isoform 3 is expressed predominantly in adult testis, weakly in pancreas, embryonic testis and sperm, and at very low levels in other organs. {ECO
• Sequence:

  MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLEGLSDL
  STIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKN
  LPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDN
  YPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
  SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQ
  MNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVL
  SKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAI
  PPSLTDYSVPFHHTPISSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSS
  RSETGVITSSGSNIPDIISLD

• Structural information:
  • Protein Domains: (11..4-)
    (/note="SAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00186-)
    (134..29-)
    (/note="PINIT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00799"-)
  • Interpro: IPR027228  IPR023321  IPR038654  IPR003034  IPR036361   IPR004181  IPR013083  
  • Prosite: PS51466 PS50800 PS51044
  • PDB: 2ASQ 4FO9
  • PDBsum: 2ASQ 4FO9
  • STRING: ENSP00000465676
• Other Databases: GeneCards:  PIAS2  Malacards:  PIAS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0061665	SUMO ligase activity	IBA	molecular function
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016925	protein sumoylation	IBA	biological process
GO:0060766	negative regulation of androgen receptor signaling pathway	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016605	PML body	IDA	colocalizes with
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0019789	SUMO transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008270	zinc ion binding	TAS	molecular function
GO:0019789	SUMO transferase activity	EXP	molecular function
GO:0019789	SUMO transferase activity	EXP	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0019789	SUMO transferase activity	IEA	molecular function
GO:0016925	protein sumoylation	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0061665	SUMO ligase activity	IDA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016925	protein sumoylation	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray