• Gene id: 90627

Gene Summary

• Gene Symbol: STARD13   Gene   UCSC   Ensembl
• Aliases: ARHGAP37, DLC2, GT650, LINC00464
• Gene name: StAR related lipid transfer domain containing 13
• Alternate names: stAR-related lipid transfer protein 13, Rho GTPase activating protein on chromosome 13q12, StAR-related lipid transfer (START) domain containing 13, deleted in liver cancer 2 protein, long intergenic non-protein coding RNA 464,
• Gene location: 13q13.1-q13.2 (33676828: 33103136)     Exons: 23     NC_000013.11
• Gene summary(Entrez): This gene encodes a protein which contains an N-terminal sterile alpha motif (SAM) for protein-protein interactions, followed by an ATP/GTP-binding motif, a GTPase-activating protein (GAP) domain, and a C-terminal STAR-related lipid transfer (START) domai
• OMIM: 609866

Protein Summary

• Protein general information: Q9Y3M8  
  • Name: StAR related lipid transfer protein 13 (46H23.2) (Deleted in liver cancer 2 protein) (DLC 2) (Rho GTPase activating protein) (START domain containing protein 13) (StARD13)
  • Length: 1113  
  • Mass: 124967
  • Tissue specificity: Ubiquitously expressed. Underexpressed in hepatocellular carcinoma cells and some breast cancer cell lines. {ECO
• Sequence:

  MFSQVPRTPASGCYYLNSMTPEGQEMYLRFDQTTRRSPYRMSRILARHQLVTKIQQEIEAKEACDWLRAAGFPQY
  AQLYEDSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASMKLDVNFQRKKGDDSDEEDLCISNKWTFQRTS
  RRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCCTDNPVMLDA
  PLVSSSLPQPPRDVLNHPFHPKNEKPTRARAKSFLKRMETLRGKGAHGRHKGSGRTGGLVISGPMLQQEPESFKA
  MQCIQIPNGDLQNSPPPACRKGLPCSGKSSGESSPSEHSSSGVSTPCLKERKCHEANKRGGMYLEDLDVLAGTAL
  PDAGDQSRMHEFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDSSNGVNWRTGSISLGREQVPGAREPRLMASC
  HRASRVSIYDNVPGSHLYASTGDLLDLEKDDLFPHLDDILQHVNGLQEVVDDWSKDVLPELQTHDTLVGEPGLST
  FPSPNQITLDFEGNSVSEGRTTPSDVERDVTSLNESEPPGVRDRRDSGVGASLTRPNRRLRWNSFQLSHQPRPAP
  ASPHISSQTASQLSLLQRFSLLRLTAIMEKHSMSNKHGWTWSVPKFMKRMKVPDYKDKAVFGVPLIVHVQRTGQP
  LPQSIQQALRYLRSNCLDQVGLFRKSGVKSRIHALRQMNENFPENVNYEDQSAYDVADMVKQFFRDLPEPLFTNK
  LSETFLHIYQYVSKEQRLQAVQAAILLLADENREVLQTLLCFLNDVVNLVEENQMTPMNLAVCLAPSLFHLNLLK
  KESSPRVIQKKYATGKPDQKDLNENLAAAQGLAHMIMECDRLFEVPHELVAQSRNSYVEAEIHVPTLEELGTQLE
  ESGATFHTYLNHLIQGLQKEAKEKFKGWVTCSSTDNTDLAFKKVGDGNPLKLWKASVEVEAPPSVVLNRVLRERH
  LWDEDFVQWKVVETLDRQTEIYQYVLNSMAPHPSRDFVVLRTWKTDLPKGMCTLVSLSVEHEEAQLLGGVRAVVM
  DSQYLIEPCGSGKSRLTHICRIDLKGHSPEWYSKGFGHLCAAEVARIRNSFQPLIAEGPETKI

• Structural information:
  • Protein Domains: (55..12-)
    (/note="SAM-)
    (663..86-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172-)
    (899..110-)
    (/note="START-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00197"-)
  • Interpro: IPR008936  IPR000198  IPR001660  IPR013761  IPR023393   IPR002913  
  • Prosite: PS50238 PS50848
  • PDB: 2H80 2JW2 2PSO
  • PDBsum: 2H80 2JW2 2PSO
  • STRING: ENSP00000338785
• Other Databases: GeneCards:  STARD13  Malacards:  STARD13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0035023	regulation of Rho protein signal transduction	IBA	biological process
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005811	lipid droplet	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0097498	endothelial tube lumen extension	IGI	biological process
GO:0097498	endothelial tube lumen extension	IMP	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IGI	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0043542	endothelial cell migration	IGI	biological process
GO:0043542	endothelial cell migration	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005811	lipid droplet	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq