• Gene id: 90624

Gene Summary

• Gene Symbol: LYRM7   Gene   UCSC   Ensembl
• Aliases: C5orf31, MC3DN8, MZM1L
• Gene name: LYR motif containing 7
• Alternate names: complex III assembly factor LYRM7, LYR motif-containing protein 7, Lyrm7 homolog,
• Gene location: 5q23.3-q31.1 (131170943: 131205427)     Exons: 5     NC_000005.10
• Gene summary(Entrez): Inner mitochondrial membrane complex III (CIII) is the main enzyme complex in the mitochondrial respiratory chain, and Rieske Fe-S protein (UQCRFS1) is the last catalytic subunit added to the complex. The protein encoded by this gene is a nuclear-encoded
• OMIM: 615831

Protein Summary

• Protein general information: Q5U5X0  
  • Name: Complex III assembly factor LYRM7 (LYR motif containing protein 7)
  • Length: 104  
  • Mass: 11955
• Sequence:

  MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIH
  TDHNTLKLVPRKDLLVENVPYCDAPTQKQ

• Structural information:
  • Interpro: IPR008011  
  • DIP: 62113
  • STRING: ENSP00000368688
• Other Databases: GeneCards:  LYRM7  Malacards:  LYRM7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0034551	mitochondrial respiratory chain complex III assembly	IDA	biological process
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0045333	cellular respiration	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Mitochondrial complex III deficiency	KEGG:H02086
Mitochondrial complex III deficiency	KEGG:H02086
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray