• Gene id: 9060

Gene Summary

• Gene Symbol: PAPSS2   Gene   UCSC   Ensembl
• Aliases: ATPSK2, BCYM4, SK2
• Gene name: 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• Alternate names: bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2, ATP sulfurylase/APS kinase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, PAPS synthase 2, PAPS synthetase 2, SK 2, adenosine 5'-ph,
• Gene location: 10q23.2-q23.31 (87659877: 87747704)     Exons: 13     NC_000010.11
• Gene summary(Entrez): Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate.
• OMIM: 123885

Protein Summary

• Protein general information: O95340  
  • Name: Bifunctional 3' phosphoadenosine 5' phosphosulfate synthase 2 (PAPS synthase 2) (PAPSS 2) (Sulfurylase kinase 2) (SK 2) (SK2) [Includes: Sulfate adenylyltransferase (EC 2.7.7.4) (ATP sulfurylase) (Sulfate adenylate transferase) (SAT); Adenylyl sulfate kin
  • Length: 614  
  • Mass: 69501
  • Tissue specificity: Expressed in cartilage and adrenal gland. {ECO
• Sequence:

  MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYS
  LDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDA
  PLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIH
  ELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDDGVINMSIPIVL
  PVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTCTKHPHIKMVMESGDWLVGGDLQVLE
  KIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKD
  DDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGPTEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKD
  LYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKA
  WKVLTDYYRSLEKN

• Structural information:
  • Interpro: IPR002891  IPR025980  IPR027417  IPR015947  IPR014729   IPR024951  IPR002650  
  • CDD: cd02027 cd00517
  • PDB: 2AX4
  • PDBsum: 2AX4
  • STRING: ENSP00000406157
• Other Databases: GeneCards:  PAPSS2  Malacards:  PAPSS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000103	sulfate assimilation	IEA	biological process
GO:0004781	sulfate adenylyltransferase (ATP) activity	ISS	molecular function
GO:0016779	nucleotidyltransferase activity	ISS	molecular function
GO:0004020	adenylylsulfate kinase activity	IEA	molecular function
GO:0000103	sulfate assimilation	IEA	biological process
GO:0004781	sulfate adenylyltransferase (ATP) activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0050428	3'-phosphoadenosine 5'-phosphosulfate biosynthetic process	IBA	biological process
GO:0000103	sulfate assimilation	IBA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0001501	skeletal system development	TAS	biological process
GO:0004020	adenylylsulfate kinase activity	IEA	molecular function
GO:0004781	sulfate adenylyltransferase (ATP) activity	IEA	molecular function
GO:0050428	3'-phosphoadenosine 5'-phosphosulfate biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004020	adenylylsulfate kinase activity	IEA	molecular function
GO:0007596	blood coagulation	IEA	biological process
GO:0000103	sulfate assimilation	IEA	biological process
GO:0004781	sulfate adenylyltransferase (ATP) activity	IEA	molecular function
GO:0060348	bone development	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa00450	Selenocompound metabolism
hsa00920	Sulfur metabolism

Diseases

Associated diseases	References
Brachyolmia	KEGG:H00522
SEMD	KEGG:H00761
Brachyolmia	KEGG:H00522
SEMD, Pakistani type	KEGG:H00761
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881