• Gene id: 9055

Gene Summary

• Gene Symbol: PRC1   Gene   UCSC   Ensembl
• Aliases: ASE1
• Gene name: protein regulator of cytokinesis 1
• Alternate names: protein regulator of cytokinesis 1, anaphase spindle elongation 1 homolog, protein regulating cytokinesis 1,
• Gene location: 15q26.1 (143213217: 143217169)     Exons: 4     NC_000008.11
• Gene summary(Entrez): This gene encodes a protein that is involved in cytokinesis. The protein is present at high levels during the S and G2/M phases of mitosis but its levels drop dramatically when the cell exits mitosis and enters the G1 phase. It is located in the nucleus d
• OMIM: 603484

Protein Summary

• Protein general information: O43663  
  • Name: Protein regulator of cytokinesis 1
  • Length: 620  
  • Mass: 71607
  • Tissue specificity: Overexpressed in bladder cancer cells (PubMed
• Sequence:

  MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKE
  LNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSL
  EELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQL
  EMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVE
  LVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDP
  NRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQER
  QLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKP
  VAASTCSGKKTPRTGRHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQREL
  SKASKSDATSGILNSTNIQS

• Structural information:
  • Interpro: IPR007145  IPR032921  
  • PDB: 3NRX 3NRY 4L3I 4L6Y 5KMG
  • PDBsum: 3NRX 3NRY 4L3I 4L6Y 5KMG
  • DIP: 34436
  • STRING: ENSP00000377793
• Other Databases: GeneCards:  PRC1  Malacards:  PRC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990023	mitotic spindle midzone	IBA	cellular component
GO:0051256	mitotic spindle midzone assembly	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0005819	spindle	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0000281	mitotic cytokinesis	IBA	biological process
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0070938	contractile ring	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0032465	regulation of cytokinesis	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019894	kinesin binding	IPI	molecular function
GO:0019894	kinesin binding	IPI	molecular function
GO:0019894	kinesin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0032465	regulation of cytokinesis	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000022	mitotic spindle elongation	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005876	spindle microtubule	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray