• Gene id: 90529

Gene Summary

• Gene Symbol: STPG1   Gene   UCSC   Ensembl
• Aliases: C1orf201, MAPO2
• Gene name: sperm tail PG-rich repeat containing 1
• Alternate names: O(6)-methylguanine-induced apoptosis 2, O6-methylguanine-induced apoptosis 2, UPF0490 protein C1orf201, sperm-tail PG-rich repeat-containing protein 1,
• Gene location: 1p36.11 (24415532: 24356998)     Exons: 12     NC_000001.11
• OMIM: 607795

Protein Summary

• Protein general information: Q5TH74  
  • Name: O(6) methylguanine induced apoptosis 2 (MAPO2) (Sperm tail PG rich repeat containing protein 1)
  • Length: 334  
  • Mass: 36786
• Sequence:

  MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIPESEKKGFNSQAKRFPHKKNDIPGPGFYNVI
  HQSPVSNSVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIPSDFISKRDFSNSCSSMFQLPSFMKALKFETPAP
  NYYNASVSCCKQRNNVCTRAGFMSKTQRGSFAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLTSTG
  PGPGYYNPSDCTKVPKKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVSNTSRWTAA
  PPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL

• Structural information:
  • Interpro: IPR010736  
  • STRING: ENSP00000363530
• Other Databases: GeneCards:  STPG1  Malacards:  STPG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902110	positive regulation of mitochondrial membrane permeability involved in apoptotic process	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0003674	molecular_function	ND	molecular function
GO:1902110	positive regulation of mitochondrial membrane permeability involved in apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R