• Gene id: 9052

Gene Summary

• Gene Symbol: GPRC5A   Gene   UCSC   Ensembl
• Aliases: GPCR5A, PEIG-1, RAI3, RAIG1, TIG1
• Gene name: G protein-coupled receptor class C group 5 member A
• Alternate names: retinoic acid-induced protein 3, G-protein coupled receptor family C group 5 member A, TPA induced gene 1, orphan G-protein-coupling receptor PEIG-1, phorbol ester induced gene 1, phorbol ester induced protein-1, retinoic acid induced 3, retinoic acid responsive,
• Gene location: 12p13.1 (12891561: 12917936)     Exons: 4     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic

Protein Summary

• Protein general information: Q8NFJ5  
  • Name: Retinoic acid induced protein 3 (G protein coupled receptor family C group 5 member A) (Phorbol ester induced gene 1) (PEIG 1) (Retinoic acid induced gene 1 protein) (RAIG 1)
  • Length: 357  
  • Mass: 40251
  • Tissue specificity: Expressed at high level in fetal and adult lung tissues but repressed in most human lung cancers (PubMed
• Sequence:

  MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGV
  LGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAI
  EYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWV
  AWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAY
  SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS

• Structural information:
  • Interpro: IPR017978  
  • STRING: ENSP00000014914
• Other Databases: GeneCards:  GPRC5A  Malacards:  GPRC5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070062	extracellular exosome	IBA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0030295	protein kinase activator activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0031982	vesicle	IDA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R